Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TL1A/TNFSF15, Mouse

The TL1A protein (VEGI protein), belongs to the tumor necrosis factor (TNF) family and is a receptor for TNFRSF25 and TNFRSF6B. TL1A is involved in the activation of NF-κB and C-Jun pathways, which can be used as a regulator of mucosal immunity and participate in the immune pathway of inflammatory bowel disease (IBD) pathogenesis[1][2]. TL1A originates from endothelial cells and inhibits the proliferation of breast cancer, epithelial and myeloid tumor cells[3]. The mouse TL1A protein has a transmembrane domain (40-60 a.a.) that can be cleaved into membrane-type and soluble peptide fragments. TL1A/TNFSF15 Protein, Mouse is the extracullar part of TL1A protein (I76-L252), produced in E.coli with tag free.

Product Specifications

Product Name Alternative

TL1A/TNFSF15 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tl1a-tnfsf15-protein-mouse.html

Purity

95.0

Smiles

ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

Molecular Formula

326623 (Gene_ID) B2RR33/AAV33431.1 (I76-L252) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Furfaro F, et al. TL1A: A New Potential Target in the Treatment of Inflammatory Bowel Disease. Curr Drug Targets. 2021;22 (7) :760-769.|[2]Migone TS, et al. TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator. Immunity. 2002 Mar;16 (3) :479-92.|[3]Haridas V, et al. VEGI, a new member of the TNF family activates nuclear factor-kappa B and c-Jun N-terminal kinase and modulates cell growth. Oncogene. 1999 Nov 11;18 (47) :6496-504.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPRC Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61782R-BF350 100 µL

NPRC Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
CCDC25 Human
PT-A00694-01 5 µg

CCDC25 Human

Sign In for Pricing
View Details
CCDC25 Human
PT-A00694-02 20 µg

CCDC25 Human

Sign In for Pricing
View Details
CCDC25 Human
PT-A00694-03 1 mg

CCDC25 Human

Sign In for Pricing
View Details
MFSD6 siRNA (Mouse)
MBS8228095-01 15 nmol

MFSD6 siRNA (Mouse)

Sign In for Pricing
View Details
MFSD6 siRNA (Mouse)
MBS8228095-02 30 nmol

MFSD6 siRNA (Mouse)

Sign In for Pricing
View Details