Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DC-SIGN/CD209, Human (HEK293, Fc)

The DC-SIGN/CD209 protein is expressed on immature dendritic cells (DC) and is an important pathogen recognition receptor that initiates primary immune responses. It mediates endocytosis and subsequent degradation of pathogens within the lysosomal compartment. DC-SIGN/CD209 Protein, Human (HEK293, Fc) is the recombinant human-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

DC-SIGN/CD209 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dc-sign-cd209-protein-human-hek-293-fc.html

Purity

98.00

Smiles

QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Molecular Formula

30835 (Gene_ID) Q9NNX6-1 (Q59-A404) (Accession)

Molecular Weight

Approximately 78 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vitamin C Impurity 1
RM-V307799-01 10 mg

Vitamin C Impurity 1

Sign In for Pricing
View Details
Vitamin C Impurity 1
RM-V307799-02 25 mg

Vitamin C Impurity 1

Sign In for Pricing
View Details
Vitamin C Impurity 1
RM-V307799-03 50 mg

Vitamin C Impurity 1

Sign In for Pricing
View Details
Vitamin C Impurity 1
RM-V307799-04 100 mg

Vitamin C Impurity 1

Sign In for Pricing
View Details
IGSF6, ID (IGSF6, DORA, Immunoglobulin superfamily member 6, Protein DORA) (AP)
MBS6309596-01 0.2 mL

IGSF6, ID (IGSF6, DORA, Immunoglobulin superfamily member 6, Protein DORA) (AP)

Sign In for Pricing
View Details
IGSF6, ID (IGSF6, DORA, Immunoglobulin superfamily member 6, Protein DORA) (AP)
MBS6309596-02 5x 0.2 mL

IGSF6, ID (IGSF6, DORA, Immunoglobulin superfamily member 6, Protein DORA) (AP)

Sign In for Pricing
View Details