Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stathmin, Human (His)

Stathmin Protein, a widely distributed cytosolic phosphoprotein, integrates regulatory signals and destabilizes microtubules, crucial for their assembly and disassembly. It exhibits broad expression in various tissues, highlighting its versatile role in cellular processes. Stathmin Protein, Human (His) is the recombinant human-derived Stathmin protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Stathmin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stathmin-protein-human-n-his.html

Purity

92.70

Smiles

MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Molecular Formula

3925 (Gene_ID) P16949-1/NP_981946.1 (M1-D149) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cip4 (TRIP10) Human Gene Knockout Kit (CRISPR)
KN401200 1 Kit

Cip4 (TRIP10) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse FcεRII/CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit
E-EL-M2432-01 24 Tests

Mouse FcεRII/CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit

Sign In for Pricing
View Details
Mouse FcεRII/CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit
E-EL-M2432-02 48 Tests

Mouse FcεRII/CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit

Sign In for Pricing
View Details
Mouse FcεRII/CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit
E-EL-M2432-03 96 Tests

Mouse FcεRII/CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit

Sign In for Pricing
View Details
L-Homoarginine-d4 Dihydrochloride
TRC-H585002-1MG 1 mg

L-Homoarginine-d4 Dihydrochloride

Sign In for Pricing
View Details
Mouse Crybb1 activation kit by CRISPRa
GA200899 1 Kit

Mouse Crybb1 activation kit by CRISPRa

Sign In for Pricing
View Details