Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stathmin, Human (His)

Stathmin Protein, a widely distributed cytosolic phosphoprotein, integrates regulatory signals and destabilizes microtubules, crucial for their assembly and disassembly. It exhibits broad expression in various tissues, highlighting its versatile role in cellular processes. Stathmin Protein, Human (His) is the recombinant human-derived Stathmin protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Stathmin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stathmin-protein-human-n-his.html

Purity

92.70

Smiles

MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Molecular Formula

3925 (Gene_ID) P16949-1/NP_981946.1 (M1-D149) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTRR Rabbit Polyclonal Antibody
TA378788 100 µL

MTRR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Coumarin 307
TRC-C755513-100MG 100 mg

Coumarin 307

Sign In for Pricing
View Details
Human KRTAP10-1 activation kit by CRISPRa
GA117862 1 Kit

Human KRTAP10-1 activation kit by CRISPRa

Sign In for Pricing
View Details
NDUFB3 Mouse Monoclonal Antibody [Clone ID: OTI2G5]
CF810650 100 µg

NDUFB3 Mouse Monoclonal Antibody [Clone ID: OTI2G5]

Sign In for Pricing
View Details
Mouse IgG kappa, AlpSdAbs® VHH
HA710261 100 µg

Mouse IgG kappa, AlpSdAbs® VHH

Sign In for Pricing
View Details
Emc4 (NM_026519) Mouse Tagged ORF Clone
MG201671 10 µg

Emc4 (NM_026519) Mouse Tagged ORF Clone

Sign In for Pricing
View Details