Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stathmin, Human (His)

Stathmin Protein, a widely distributed cytosolic phosphoprotein, integrates regulatory signals and destabilizes microtubules, crucial for their assembly and disassembly. It exhibits broad expression in various tissues, highlighting its versatile role in cellular processes. Stathmin Protein, Human (His) is the recombinant human-derived Stathmin protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Stathmin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stathmin-protein-human-n-his.html

Purity

92.70

Smiles

MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Molecular Formula

3925 (Gene_ID) P16949-1/NP_981946.1 (M1-D149) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS651146 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
SPR Recombinant Rabbit monoclonal Antibody
HA751052 100 µL

SPR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PAX5/2060), 0.2mg/mL
BNUB2060-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PAX5/2060), 0.2mg/mL

Sign In for Pricing
View Details
TRPV4 Recombinant Rabbit monoclonal Antibody
HA723855 100 µL

TRPV4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS644362 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Human PTPLAD1 (HACD3) activation kit by CRISPRa
GA109834 1 Kit

Human PTPLAD1 (HACD3) activation kit by CRISPRa

Sign In for Pricing
View Details