Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DPA1, Human (His)

The HLA-DPA1 protein is critical in the immune system, binding antigens in the endocytic pathway of APCs and presenting them to the cell surface for recognition by CD4 T cells. The peptide binding cleft can accommodate peptides of 10-30 residues, mainly resulting from protein degradation. HLA-DPA1 Protein, Human (His) is the recombinant human-derived HLA-DPA1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HLA-DPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-dpa1-protein-human-his.html

Purity

96.00

Smiles

AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTE

Molecular Formula

3113 (Gene_ID) P20036 (A29-E222) (Accession)

Molecular Weight

31 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-100 1x 100 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF405S conjugate, 0.1mg/mL
BNC041481-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (ASTRO/789), CF594 conjugate, 0.1mg/mL
BNC940789-100 1x 100 µL

GFAP (ASTRO/789), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), Biotin conjugate, 0.1mg/mL
BNCB0003-100 1x 100 µL

CD45RO (UCHL-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details