Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DPA1, Human (His)

The HLA-DPA1 protein is critical in the immune system, binding antigens in the endocytic pathway of APCs and presenting them to the cell surface for recognition by CD4 T cells. The peptide binding cleft can accommodate peptides of 10-30 residues, mainly resulting from protein degradation. HLA-DPA1 Protein, Human (His) is the recombinant human-derived HLA-DPA1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HLA-DPA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-dpa1-protein-human-his.html

Purity

96.00

Smiles

AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTE

Molecular Formula

3113 (Gene_ID) P20036 (A29-E222) (Accession)

Molecular Weight

31 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLASP1 Protein Vector (Mouse) (pPM-C-HA)
PV165768 500 ng

CLASP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human Cytochrome p450 2J2 Protein - (Dry Ice)
H00001573-Q01-10ug 10 µg

Recombinant Human Cytochrome p450 2J2 Protein - (Dry Ice)

Sign In for Pricing
View Details
Human KLK5 (Kallikrein-5) Quick ELISA Kit
orb2568543-01 48 Tests

Human KLK5 (Kallikrein-5) Quick ELISA Kit

Sign In for Pricing
View Details
Human KLK5 (Kallikrein-5) Quick ELISA Kit
orb2568543-02 96 Tests

Human KLK5 (Kallikrein-5) Quick ELISA Kit

Sign In for Pricing
View Details
(-) - (1R,3S) -N-Fmoc-3-Aminocyclopentanecarboxy lic acid
CSB-DT3349 1 g

(-) - (1R,3S) -N-Fmoc-3-Aminocyclopentanecarboxy lic acid

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-conjugating Enzyme E2 R1
P1591-.005 5 µg

Recombinant Human Ubiquitin-conjugating Enzyme E2 R1

Sign In for Pricing
View Details