Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)

Product Specifications

Product Name Alternative

B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD79a

Abbreviation

Recombinant Human CD79A protein, partial (Active)

Gene Name

CD79A

UniProt

P11912

Expression Region

33-143aa

Organism

Homo sapiens (Human)

Target Sequence

LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/mL can bind Anti-CD79A recombinant antibody (CSB-RA004957MA1HU) . The EC50 is 1.521-1.700 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.0 kDa

References & Citations

Immunoglobulin A levels and its correlation with neutrophil-to-lymphocyte ratio as inflammatory biomarkers for dry eye disease in type 2 diabetes: a retrospective study. Alhalwani A.Y., Abudawood K., Qadizadah A.B.E.A., Jambi S., Sannan N.S. Front Immunol 14:1184862-1184862 (2023)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEL1L (Center) Rabbit Polyclonal Antibody
AP53837PU-N 400 µL

SEL1L (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAB39L (NM_001079670) Human Recombinant Protein
TP311881L 1 mg

CAB39L (NM_001079670) Human Recombinant Protein

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF568 conjugate, 0.1mg/mL
BNC682363-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Silver(I) Oxide
TRC-S465053-25G 25 g

Silver(I) Oxide

Sign In for Pricing
View Details
Human RARRES1 activation kit by CRISPRa
GA104028 1 Kit

Human RARRES1 activation kit by CRISPRa

Sign In for Pricing
View Details
NR2C1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D11]
TA803354AM 100 µL

NR2C1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D11]

Sign In for Pricing
View Details