Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDI2, Human (P.pastoris, His)

GDI2 protein inhibits the exchange of GDP to GTP in Rab proteins and regulates intracellular membrane transport. GDI2 Protein, Human (P.pastoris, His) is the recombinant human-derived GDI2 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDI2 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdi2-protein-human-p-pastoris-his.html

Smiles

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Molecular Formula

2665 (Gene_ID) P50395 (M1-D445) (Accession)

Molecular Weight

Approximately 52.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bisphenol G-d6
TRC-B519519-2.5MG 2.5 mg

Bisphenol G-d6

Sign In for Pricing
View Details
Stathmin 1 (STMN1) Rabbit Polyclonal Antibody
AP02726PU-N 100 µL

Stathmin 1 (STMN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cortisol-1,2-d2
TRC-H714616-2.5MG 2.5 mg

Cortisol-1,2-d2

Sign In for Pricing
View Details
Human GTL3B (NATD1) activation kit by CRISPRa
GA116855 1 Kit

Human GTL3B (NATD1) activation kit by CRISPRa

Sign In for Pricing
View Details
PDIA6 (NM_005742) Human Over-expression Lysate
LY401760 100 µg

PDIA6 (NM_005742) Human Over-expression Lysate

Sign In for Pricing
View Details
COQ6 (N-term) Rabbit Polyclonal Antibody
AP51027PU-N 400 µL

COQ6 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details