Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDI2, Human (P.pastoris, His)

GDI2 protein inhibits the exchange of GDP to GTP in Rab proteins and regulates intracellular membrane transport. GDI2 Protein, Human (P.pastoris, His) is the recombinant human-derived GDI2 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDI2 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdi2-protein-human-p-pastoris-his.html

Smiles

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Molecular Formula

2665 (Gene_ID) P50395 (M1-D445) (Accession)

Molecular Weight

Approximately 52.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Annexin A2 (ANXA2) ELISA Kit
RD-ANXA2-Hu-01 96 Tests

Human Annexin A2 (ANXA2) ELISA Kit

Sign In for Pricing
View Details
Human Annexin A2 (ANXA2) ELISA Kit
RD-ANXA2-Hu-02 48 Tests

Human Annexin A2 (ANXA2) ELISA Kit

Sign In for Pricing
View Details
FOXI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H5]
TA800143BM 100 µL

FOXI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H5]

Sign In for Pricing
View Details
Panobinostat (LBH-589)
TRC-P180500-5MG 5 mg

Panobinostat (LBH-589)

Sign In for Pricing
View Details
SPA17 Antibody
OC-846-01 50 μL

SPA17 Antibody

Sign In for Pricing
View Details
SPA17 Antibody
OC-846-02 100 µL

SPA17 Antibody

Sign In for Pricing
View Details