Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial, Biotinylated

Product Specifications

Abbreviation

Recombinant Human CHRNA1 protein, partial, Biotinylated

Gene Name

CHRNA1

UniProt

P02708

Expression Region

21-255aa

Organism

Homo sapiens (Human)

Target Sequence

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transport

Relevance

Upon acetylcholine binding, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

74.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of P02708-1

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal gamma Catenin Antibody (15F11) [Allophycocyanin/Cy7]
NBP2-54527APCCY7 0.1 mL

Mouse Monoclonal gamma Catenin Antibody (15F11) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Hepatitis B Virus/Hepatitis C Virus/Human Immunodeficiency Virus Type 1 Nucleic Acid Detection Kit (Fluorescence Quantitative PCR)
BSB110S1 24 Tests

Hepatitis B Virus/Hepatitis C Virus/Human Immunodeficiency Virus Type 1 Nucleic Acid Detection Kit (Fluorescence Quantitative PCR)

Sign In for Pricing
View Details
Chicken Frizzled-8, FZD8 ELISA Kit
MBS9327578 Inquire

Chicken Frizzled-8, FZD8 ELISA Kit

Sign In for Pricing
View Details
1- (2-Bromophenyl) ethylamine
sc-258400A 1 g

1- (2-Bromophenyl) ethylamine

Sign In for Pricing
View Details
DMRTC2, ID (DMRTC2, Doublesex- and mab-3-related transcription factor C2) (Azide free) (HRP) discontinued
034686-HRP 200 µL

DMRTC2, ID (DMRTC2, Doublesex- and mab-3-related transcription factor C2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
KIAA1456 ORF Vector (Human) (pORF)
ORF022240 1.0 µg DNA

KIAA1456 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details