Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99L2, Human (HEK293, His)

The CD99L2 protein plays a critical role in late leukocyte extravasation, helping cells to overcome the endothelial basement membrane. It acts independently at the same site as PECAM1, coordinating but uniquely participating in the complex process of leukocyte migration. CD99L2 Protein, Human (HEK293, His) is the recombinant human-derived CD99L2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD99L2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99l2-protein-human-hek-293-his.html

Smiles

DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIA

Molecular Formula

83692 (Gene_ID) Q8TCZ2-1 (D26-A188) (Accession)

Molecular Weight

Approximately 25-55 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP3 (NM_000362) Human Over-expression Lysate
LC400129 20 µg

TIMP3 (NM_000362) Human Over-expression Lysate

Sign In for Pricing
View Details
TOLLIP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]
TA506966AM 100 µL

TOLLIP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details
4-Formylpiperidine-1-carboxylic Acid tert-Butyl Ester
TRC-F700925-5G 5 g

4-Formylpiperidine-1-carboxylic Acid tert-Butyl Ester

Sign In for Pricing
View Details
EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF594 conjugate, 0.1mg/mL
BNC942600-100 1x 100 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DFFB (N-term) Rabbit Polyclonal Antibody
AP51245PU-N 400 µL

DFFB (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GAPDHS (NM_014364) Human Over-expression Lysate
LY402320 100 µg

GAPDHS (NM_014364) Human Over-expression Lysate

Sign In for Pricing
View Details