Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99L2, Human (HEK293, His)

The CD99L2 protein plays a critical role in late leukocyte extravasation, helping cells to overcome the endothelial basement membrane. It acts independently at the same site as PECAM1, coordinating but uniquely participating in the complex process of leukocyte migration. CD99L2 Protein, Human (HEK293, His) is the recombinant human-derived CD99L2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD99L2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99l2-protein-human-hek-293-his.html

Smiles

DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIA

Molecular Formula

83692 (Gene_ID) Q8TCZ2-1 (D26-A188) (Accession)

Molecular Weight

Approximately 25-55 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF647 conjugate, 0.1mg/mL
BNC471706-100 1x 100 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apc2 (ANAPC2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]
TA503573AM 100 µL

Apc2 (ANAPC2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]

Sign In for Pricing
View Details
MEIS1 Recombinant Rabbit Monoclonal Antibody [JA13-26]
ET1704-84 100 µL

MEIS1 Recombinant Rabbit Monoclonal Antibody [JA13-26]

Sign In for Pricing
View Details
1-(2-Hydroxyethyl) Ester, 1,4-Benzenedicarboxylic Acid
TRC-H113790-50MG 50 mg

1-(2-Hydroxyethyl) Ester, 1,4-Benzenedicarboxylic Acid

Sign In for Pricing
View Details
Daprodustat
TRC-D193368-25MG 25 mg

Daprodustat

Sign In for Pricing
View Details
Ferritin Conjugated Canavalia ensiformis Lectin (Jackbean) -Con A-
I-1104-1 1 mg

Ferritin Conjugated Canavalia ensiformis Lectin (Jackbean) -Con A-

Sign In for Pricing
View Details