Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

Product Specifications

Product Name Alternative

Nucleocapsid protein; NC; Protein N

Abbreviation

Recombinant Avian infectious bronchitis virus N protein

Gene Name

N

UniProt

Q82616

Expression Region

1-409aa

Organism

Avian infectious bronchitis virus (strain M41) (IBV)

Target Sequence

MASGKATGKTDAPAPVIKLGGPKPPKVGSSGNASWFQAIKANKLNIPPPKFEGSGVPDNENLKSSQQHGYWRRQATFKPGKGGRKPVPDAWYFYYTGTGPAANLNWGDSQDGIVWVAGKGADTKFRSNQGTRDSDKFDQYPLRFSDGGPDGNFRWDFIPLNGGRSGRSTAASSAASSRAPSREVSRGRRSGSEDDLIARAARIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPNYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPKDDEPRPKSRSSSRPATRGNSPAPRQQRPKKEKKPKKHDDEVDKALTSDEERNNAQLEFYDEPKVINWGDAALGENEL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Microbiology

Relevance

Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.3 kDa

References & Citations

"Development and evaluation of a real-time Taqman RT-PCR assay for the detection of infectious bronchitis virus from infected chickens." Callison S.A., Hilt D.A., Boynton T.O., Sample B.F., Robison R., Swayne D.E., Jackwood M.W. J. Virol. Methods 138:60-65 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF534 Human qPCR Primer Pair (NM_001143939)
HP232729 200 Reactions

ZNF534 Human qPCR Primer Pair (NM_001143939)

Sign In for Pricing
View Details
Spink14 Mouse Gene Knockout Kit (CRISPR)
KN516615 1 Kit

Spink14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM180B (NM_001164379) Human Over-expression Lysate
LY431146 100 µg

FAM180B (NM_001164379) Human Over-expression Lysate

Sign In for Pricing
View Details
HMX1 (NM_018942) Human Recombinant Protein
TP317611M 100 µg

HMX1 (NM_018942) Human Recombinant Protein

Sign In for Pricing
View Details
CARD12 (NLRC4) Human Gene Knockout Kit (CRISPR)
KN206757RB 1 Kit

CARD12 (NLRC4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SOD2 Antibody Pair Set
E-KAB-0238 50 µL & 100 µg

Human SOD2 Antibody Pair Set

Sign In for Pricing
View Details