Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free NAP-2/CXCL7, Mouse (62a.a, His)

NAP-2/CXCL7 proteins are members of the intercrine alpha family and are associated with chemokines that regulate intercellular communication and immune responses. As part of this family, NAP-2/CXCL7 may regulate inflammatory processes and cellular interactions. Animal-Free NAP-2/CXCL7 Protein, Mouse (62a.a, His) is the recombinant mouse-derived animal-FreeNAP-2/CXCL7 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free NAP-2/CXCL7 Protein, Mouse (62a.a, His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-nap-2-cxcl7-protein-mouse-his-62-a-a.html

Purity

95.0

Smiles

IELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKI

Molecular Formula

57349 (Gene_ID) Q9EQI5 (I48-Y113) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chymase 1, Mast Cell (Biotin)
545916 200 µL

Chymase 1, Mast Cell (Biotin)

Sign In for Pricing
View Details
Fmoc-3,5-diiodo-D-tyrosine
sc-327688A 5 g

Fmoc-3,5-diiodo-D-tyrosine

Sign In for Pricing
View Details
mIgG protein
30R-2150 50 ug

mIgG protein

Sign In for Pricing
View Details
Fmoc-N-Me-D-Nva-OH
5-05037 1 g

Fmoc-N-Me-D-Nva-OH

Sign In for Pricing
View Details
2-Amino-3-methyl-3H-imidazo[4,5-f]quinoline-2- (13) C
OR1660T 1 Each

2-Amino-3-methyl-3H-imidazo[4,5-f]quinoline-2- (13) C

Sign In for Pricing
View Details
Rat Polypyrimidine tract-binding protein 1 ELISA Kit
orb1659649 96 Tests

Rat Polypyrimidine tract-binding protein 1 ELISA Kit

Sign In for Pricing
View Details