Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CCR4-NOT transcription complex subunit 7 (CNOT7)

Product Specifications

Product Name Alternative

BTG1-binding factor 1; CCR4-associated factor 1; CAF-1; Caf1a

Abbreviation

Recombinant Human CNOT7 protein

Gene Name

CNOT7

UniProt

Q9UIV1

Expression Region

1-285aa

Organism

Homo sapiens (Human)

Target Sequence

MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Has 3'-5' poly (A) exoribonuclease activity for synthetic poly (A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Influenza B antibody
10-1112 500 ug

Influenza B antibody

Ask
View Details
Solute carrier family 22 member 2 (SLC22A2) Mouse ELISA Kit
H2065 96 Tests

Solute carrier family 22 member 2 (SLC22A2) Mouse ELISA Kit

Ask
View Details
Mouse Radical S-Adenosyl Methionine Domain Containing 2 (Viperin; RSAD2) ELISA Kit
YP-W23633-01 48 Tests

Mouse Radical S-Adenosyl Methionine Domain Containing 2 (Viperin; RSAD2) ELISA Kit

Ask
View Details
Mouse Radical S-Adenosyl Methionine Domain Containing 2 (Viperin; RSAD2) ELISA Kit
YP-W23633-02 96 Tests

Mouse Radical S-Adenosyl Methionine Domain Containing 2 (Viperin; RSAD2) ELISA Kit

Ask
View Details