Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200, Mouse (HEK293, His)

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues.Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities.CD200 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MGSLVFRRPFCHLSTYSLIWGMAAVALSTAQVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG

Molecular Formula

17470 (Gene_ID) O54901 (Q31-G232) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Beta glucuronidase Polyclonal Antibody, Cy5 Conjugated
bs-7980R-Cy5 100 µL

Beta glucuronidase Polyclonal Antibody, Cy5 Conjugated

Ask
View Details
Mrps2 (NM_001166031) Mouse Tagged ORF Clone Lentiviral Particle
MR219185L3V 200 µL

Mrps2 (NM_001166031) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Goat Polyclonal STAG2 Antibody [Alexa Fluor 532]
NB100-300AF532 0.1 mL

Goat Polyclonal STAG2 Antibody [Alexa Fluor 532]

Ask
View Details
Caspase 3 (CASP3) Rabbit Monoclonal Antibody [Clone ID: RM250]
TA398461 100 µL

Caspase 3 (CASP3) Rabbit Monoclonal Antibody [Clone ID: RM250]

Ask
View Details
Human HLA Class 2 Histocompatibility Antigen, DQ Beta 1 Chain ELISA Kit
MBS1603563-01 48 Well

Human HLA Class 2 Histocompatibility Antigen, DQ Beta 1 Chain ELISA Kit

Ask
View Details
Human HLA Class 2 Histocompatibility Antigen, DQ Beta 1 Chain ELISA Kit
MBS1603563-02 96 Well

Human HLA Class 2 Histocompatibility Antigen, DQ Beta 1 Chain ELISA Kit

Ask
View Details