Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Mouse (His-SUMO)

The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-mouse-his-sumo.html

Smiles

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Molecular Formula

11435 (Gene_ID) P04756 (S21-L230) (Accession)

Molecular Weight

Approximately 40.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZWINT antibody
FNab09762 100 µg

ZWINT antibody

Sign In for Pricing
View Details
AHI1-DT Antibody
KC-35150-01 50 μL

AHI1-DT Antibody

Sign In for Pricing
View Details
AHI1-DT Antibody
KC-35150-02 100 µL

AHI1-DT Antibody

Sign In for Pricing
View Details
AHI1-DT Antibody
KC-35150-03 1 mL

AHI1-DT Antibody

Sign In for Pricing
View Details
IQGAP2 Antibody
KC-1337-01 50 μL

IQGAP2 Antibody

Sign In for Pricing
View Details
IQGAP2 Antibody
KC-1337-02 100 µL

IQGAP2 Antibody

Sign In for Pricing
View Details