Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2L6, Human (His)

The UBE2L6 protein plays a key role in cell regulation by catalyzing the covalent attachment of ubiquitin or ISG15 to other proteins. Notably, it plays a role in E6/E6-AP-induced ubiquitination of p53/TP53, a core process in regulating cellular responses to stress and DNA damage. UBE2L6 Protein, Human (His) is the recombinant human-derived UBE2L6 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

UBE2L6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2l6-protein-human-his.html

Purity

98.0

Smiles

MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS

Molecular Formula

9246 (Gene_ID) O14933 (M1-S153) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAPM5 rabbit pAb
MBS8599205-01 0.1 mL

LAPM5 rabbit pAb

Sign In for Pricing
View Details
LAPM5 rabbit pAb
MBS8599205-02 0.1 mL (AF405L)

LAPM5 rabbit pAb

Sign In for Pricing
View Details
LAPM5 rabbit pAb
MBS8599205-03 0.1 mL (AF405S)

LAPM5 rabbit pAb

Sign In for Pricing
View Details
LAPM5 rabbit pAb
MBS8599205-04 0.1 mL (AF610)

LAPM5 rabbit pAb

Sign In for Pricing
View Details
LAPM5 rabbit pAb
MBS8599205-05 0.1 mL (AF635)

LAPM5 rabbit pAb

Sign In for Pricing
View Details
LAPM5 rabbit pAb
MBS8599205-06 0.1 mL (APC)

LAPM5 rabbit pAb

Sign In for Pricing
View Details