Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-O-Acetyl-3,5-bis (4-chlorobenzoyl) -2-deoxy-D-ribose
GC5374-2g 2 g

1-O-Acetyl-3,5-bis (4-chlorobenzoyl) -2-deoxy-D-ribose

Sign In for Pricing
View Details
Rno-miR-134-5p miRNA Agomir
CMS0106-01 5 nmol

Rno-miR-134-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-134-5p miRNA Agomir
CMS0106-02 10 nmol

Rno-miR-134-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-134-5p miRNA Agomir
CMS0106-03 20 nmol

Rno-miR-134-5p miRNA Agomir

Sign In for Pricing
View Details
Inhibin alpha Rabbit monoclonal antibody
E43S41039 100 µL

Inhibin alpha Rabbit monoclonal antibody

Sign In for Pricing
View Details
GENLISA™ Human Elastase 3A (ELA3A) ELISA
KBH20790 1x 96 Well

GENLISA™ Human Elastase 3A (ELA3A) ELISA

Sign In for Pricing
View Details