Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC15 Monoclonal Antibody, PE Conjugated
bsm-43036M-PE 100 µL

SIGLEC15 Monoclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
IGHV3-16 3'UTR Luciferase Stable Cell Line
TU010646 1.0 mL

IGHV3-16 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human MIR601 qPCR Primer Pair
QH81521S 200 Tests

Human MIR601 qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral human VPS9D1 shRNA (UAS) - Lentiviral human VPS9D1 shRNA (UAS) plasmid
GTR15095815 1 Vial

Lentiviral human VPS9D1 shRNA (UAS) - Lentiviral human VPS9D1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Gpr157 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3583605 3x 1.0 µg

Gpr157 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
CCDC144A Polyclonal Antibody, RBITC Conjugated
bs-8092R-RBITC 100 µL

CCDC144A Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details