Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF18, ID (TNFSF18, AITRL, GITRL, TL6, Tumor necrosis factor ligand superfamily member 18, Activation-inducible TNF-related ligand, Glucocorticoid-induced TNF-related ligand) (MaxLight 650)
MBS6357062-01 0.1 mL

TNFSF18, ID (TNFSF18, AITRL, GITRL, TL6, Tumor necrosis factor ligand superfamily member 18, Activation-inducible TNF-related ligand, Glucocorticoid-induced TNF-related ligand) (MaxLight 650)

Sign In for Pricing
View Details
TNFSF18, ID (TNFSF18, AITRL, GITRL, TL6, Tumor necrosis factor ligand superfamily member 18, Activation-inducible TNF-related ligand, Glucocorticoid-induced TNF-related ligand) (MaxLight 650)
MBS6357062-02 5x 0.1 mL

TNFSF18, ID (TNFSF18, AITRL, GITRL, TL6, Tumor necrosis factor ligand superfamily member 18, Activation-inducible TNF-related ligand, Glucocorticoid-induced TNF-related ligand) (MaxLight 650)

Sign In for Pricing
View Details
UBL7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2576905 3x 1.0 µg

UBL7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
GW-695634
MF-0048257-01 25 mg

GW-695634

Sign In for Pricing
View Details
GW-695634
MF-0048257-02 50 mg

GW-695634

Sign In for Pricing
View Details
GW-695634
MF-0048257-03 100 mg

GW-695634

Sign In for Pricing
View Details