Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDIT3 Antibody, FITC conjugated
A19110-100UG 100 µg

DDIT3 Antibody, FITC conjugated

Sign In for Pricing
View Details
DEFB132 3'UTR GFP Stable Cell Line
TU055799 1.0 mL

DEFB132 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NPEPL1 (Probable Aminopeptidase NPEPL1, Aminopeptidase-like 1, KIAA1974, bA261P9.2, FLJ11583, FLJ42065) (MaxLight 650)
130495-ML650 100 µL

NPEPL1 (Probable Aminopeptidase NPEPL1, Aminopeptidase-like 1, KIAA1974, bA261P9.2, FLJ11583, FLJ42065) (MaxLight 650)

Sign In for Pricing
View Details
SPHK1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
45312126 3x 1.0µg DNA

SPHK1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Plastin L (Tyr28) Blocking Peptide
MBS9615244-01 1 mg

Plastin L (Tyr28) Blocking Peptide

Sign In for Pricing
View Details
Plastin L (Tyr28) Blocking Peptide
MBS9615244-02 5x 1 mg

Plastin L (Tyr28) Blocking Peptide

Sign In for Pricing
View Details