Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Boydii nanR Protein (aa 1-263)
VAng-Lsx08725-500gEcoli 500 µg (E. coli)

Recombinant Shigella Boydii nanR Protein (aa 1-263)

Sign In for Pricing
View Details
SNRPD1 Recombinant Protein (Mouse)
RP174254 100 µg

SNRPD1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit anti-Zea mays (Maize) FDX6 Polyclonal Antibody
MBS7149932 Inquire

Rabbit anti-Zea mays (Maize) FDX6 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF283 (NM_181845) Human Over-expression Lysate
LH15854V 100 µg

ZNF283 (NM_181845) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) ELG1 Polyclonal Antibody
MBS7182632 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) ELG1 Polyclonal Antibody

Sign In for Pricing
View Details
Robo2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-7921R-BF594 100 µL

Robo2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details