Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig leucine (Leu) ELISA Kit
EIA07511Gu 1 Kit

Guinea pig leucine (Leu) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM162A (FAM162A) ELISA Kit
abx522799 96 Tests

Mouse Protein FAM162A (FAM162A) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal VEGFR1/Flt-1 Antibody (49560) [PE/Atto594]
FAB321PEATT594 0.1 mL

Mouse Monoclonal VEGFR1/Flt-1 Antibody (49560) [PE/Atto594]

Sign In for Pricing
View Details
pExpress-1-Dhx40 Plasmid
PVT46313 2 µg

pExpress-1-Dhx40 Plasmid

Sign In for Pricing
View Details
HCG27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0937407 1.0 µg DNA

HCG27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Bird Flu/Avian Influenza Virus (AIV) antibody ELISA test kit
LSY-30028 96 Well/Kit

Bird Flu/Avian Influenza Virus (AIV) antibody ELISA test kit

Sign In for Pricing
View Details