Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha Dystroglycan (DAG1) (NM_001177638) Human Tagged ORF Clone Lentiviral Particle
RC230567L4V 200 µL

Alpha Dystroglycan (DAG1) (NM_001177638) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
INH1 (Microtubule Associated inhibitor)
SC8010-25mg 25 mg

INH1 (Microtubule Associated inhibitor)

Sign In for Pricing
View Details
BCKDHA sgRNA CRISPR Lentivector (Human) (Target 2)
K0174503 1.0 µg DNA

BCKDHA sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal Cathepsin G Antibody [DyLight 680]
NBP2-99088FR 0.1 mL

Rabbit Polyclonal Cathepsin G Antibody [DyLight 680]

Sign In for Pricing
View Details
LRP1 Antibody, HRP conjugated
A27716-100UL 100 µL

LRP1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r26 shRNA (UAS) - Lentiviral mouse Vmn1r26 shRNA (UAS, GFP) plasmid
GTR15137410 1 Vial

Lentiviral mouse Vmn1r26 shRNA (UAS) - Lentiviral mouse Vmn1r26 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details