Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CLPTM1, His-tagged
CLPTM1-11345H 25 µg

Recombinant Human CLPTM1, His-tagged

Sign In for Pricing
View Details
Salivary alpha amylase (AMY1B) (NM_001008218) Human Tagged ORF Clone
RG212793 10 µg

Salivary alpha amylase (AMY1B) (NM_001008218) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anoctamin 7 (ANO7) (NM_001001891) Human Untagged Clone
SC300328 10 µg

Anoctamin 7 (ANO7) (NM_001001891) Human Untagged Clone

Sign In for Pricing
View Details
OR9G9 (NM_001013358) Human Over-expression Lysate
LH03935V 100 µg

OR9G9 (NM_001013358) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Myosin Light Chain 2, Regulatory, Cardiac (MYL2) ELISA Kit
RD-MYL2-Hu-96Tests 96 Tests

Human Myosin Light Chain 2, Regulatory, Cardiac (MYL2) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal FBXO42 Antibody (OTI1H4) [DyLight 680]
NBP2-71960FR 0.1 mL

Mouse Monoclonal FBXO42 Antibody (OTI1H4) [DyLight 680]

Sign In for Pricing
View Details