Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KLK12 Antibody
56240-1 100 µg

Anti-KLK12 Antibody

Sign In for Pricing
View Details
Frizzled Homolog 4 (FZD4) Antibody
abx240102 100 µg

Frizzled Homolog 4 (FZD4) Antibody

Sign In for Pricing
View Details
Rabbit anti-ZNF134 Antibody
MBS4504765-01 0.05 mL

Rabbit anti-ZNF134 Antibody

Sign In for Pricing
View Details
Rabbit anti-ZNF134 Antibody
MBS4504765-02 0.1 mL

Rabbit anti-ZNF134 Antibody

Sign In for Pricing
View Details
Rabbit anti-ZNF134 Antibody
MBS4504765-03 5x 0.1 mL

Rabbit anti-ZNF134 Antibody

Sign In for Pricing
View Details
2′-F-UDP
HY-171526 1 Each

2′-F-UDP

Sign In for Pricing
View Details