Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DPPA2 Antibody (Z31P3C4-F11) [Alexa Fluor 350]
NBP2-50230AF350 0.1 mL

Mouse Monoclonal DPPA2 Antibody (Z31P3C4-F11) [Alexa Fluor 350]

Sign In for Pricing
View Details
mmu-miR-7221-3p miRNA Inhibitor
MIM03012 2x 5.0 nmol

mmu-miR-7221-3p miRNA Inhibitor

Sign In for Pricing
View Details
D1Pas1 Mouse siRNA Oligo Duplex (Locus ID 110957)
SR418823 1 Kit

D1Pas1 Mouse siRNA Oligo Duplex (Locus ID 110957)

Sign In for Pricing
View Details
UNC13D Antibody
A58971-100UG 100 µg

UNC13D Antibody

Sign In for Pricing
View Details
NOS1 Polyclonal Antibody
MBS8524149-01 0.1 mg

NOS1 Polyclonal Antibody

Sign In for Pricing
View Details
NOS1 Polyclonal Antibody
MBS8524149-02 0.1 mL (AF635)

NOS1 Polyclonal Antibody

Sign In for Pricing
View Details