Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Kappa Light Chain Antibody (SPM558) [Alexa Fluor 532]
NBP2-34423AF532 0.1 mL

Mouse Monoclonal Kappa Light Chain Antibody (SPM558) [Alexa Fluor 532]

Sign In for Pricing
View Details
Troponin T (Cardiac) (HRP)
MBS6262666-01 0.1 mL

Troponin T (Cardiac) (HRP)

Sign In for Pricing
View Details
Troponin T (Cardiac) (HRP)
MBS6262666-02 5x 0.1 mL

Troponin T (Cardiac) (HRP)

Sign In for Pricing
View Details
2-Hydroxy-5-benzyloxyacetophenone
sc-209195 1 g

2-Hydroxy-5-benzyloxyacetophenone

Sign In for Pricing
View Details
Bmp4, NT (Bone Morphogenetic Protein 4, BMP-4, Bone Morphogenetic Protein 2B, BMP-2B, BMP2B) (PE) discontinued
B2553-20H-PE 200 µL

Bmp4, NT (Bone Morphogenetic Protein 4, BMP-4, Bone Morphogenetic Protein 2B, BMP-2B, BMP2B) (PE) discontinued

Sign In for Pricing
View Details
Human [Leu27]IGF-II
TU100 100 µg

Human [Leu27]IGF-II

Sign In for Pricing
View Details