Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Skp1 Pre-designed siRNA Set B
SI112972B 1 Each

Mouse Skp1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PD-L2/B7-DC, His, Mouse
Z06303-100 100 µg

PD-L2/B7-DC, His, Mouse

Sign In for Pricing
View Details
1,3-Bis (4-nitrophenyl) urea-d8
004237 2.5 mg

1,3-Bis (4-nitrophenyl) urea-d8

Sign In for Pricing
View Details
N-Acetylglycine
TRC-A178260-100G 100 g

N-Acetylglycine

Sign In for Pricing
View Details
BeyoIHCTM Chromogranin A Rabbit Monoclonal Antibody
AG8285 50 µL

BeyoIHCTM Chromogranin A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BIRT-377 50mg
A17202-50 50 mg

BIRT-377 50mg

Sign In for Pricing
View Details