Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

URAT1 Peptide
DF12340-BP 1 mg

URAT1 Peptide

Sign In for Pricing
View Details
March3 (NM_177115) Mouse Untagged Clone
MC214450 10 µg

March3 (NM_177115) Mouse Untagged Clone

Sign In for Pricing
View Details
JNK Kinase Activity Screening BioAssayTM Kit discontinued
167895 40 Tests

JNK Kinase Activity Screening BioAssayTM Kit discontinued

Sign In for Pricing
View Details
Lentiviral human CTNNBIP1 shRNA (UAS) - Lentiviral human CTNNBIP1 shRNA (UAS, RFP) (25)
GTR15334586 1 Vial

Lentiviral human CTNNBIP1 shRNA (UAS) - Lentiviral human CTNNBIP1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-CDK20 Antibody
MBS8325079-01 0.03 mL

Anti-CDK20 Antibody

Sign In for Pricing
View Details
Anti-CDK20 Antibody
MBS8325079-02 0.05 mL

Anti-CDK20 Antibody

Sign In for Pricing
View Details