Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces Cerevisiae FCF2 Protein (aa 1-217) [His]
VAng-Wyb4633-1mg 1 mg

Recombinant Saccharomyces Cerevisiae FCF2 Protein (aa 1-217) [His]

Sign In for Pricing
View Details
Il5 Mouse qPCR Primer Pair (NM_010558)
MP206796 200 Reactions

Il5 Mouse qPCR Primer Pair (NM_010558)

Sign In for Pricing
View Details
Rabbit anti-MSH2 Recombinant Monoclonal Antibody [BLR116H]
MBS3906403-01 0.1 mg

Rabbit anti-MSH2 Recombinant Monoclonal Antibody [BLR116H]

Sign In for Pricing
View Details
Rabbit anti-MSH2 Recombinant Monoclonal Antibody [BLR116H]
MBS3906403-02 5x 0.1 mg

Rabbit anti-MSH2 Recombinant Monoclonal Antibody [BLR116H]

Sign In for Pricing
View Details
Human anti-HIV-1 p24 mAb (2HAB)
A09F02-2HAB 1 Each

Human anti-HIV-1 p24 mAb (2HAB)

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Appendix (Frozen) HisTekTM
T5595-4755 5 Sections

Tissue, Section, Human Adult Normal, Appendix (Frozen) HisTekTM

Sign In for Pricing
View Details