Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D2B (NM_015079) Human Tagged ORF Clone
RC212169 10 µg

TBC1D2B (NM_015079) Human Tagged ORF Clone

Sign In for Pricing
View Details
Prcc Rat siRNA Oligo Duplex (Locus ID 310687)
SR508740 1 Kit

Prcc Rat siRNA Oligo Duplex (Locus ID 310687)

Sign In for Pricing
View Details
Histophilus somni One-Step PCR kit
Oneq-V188-150D 150T

Histophilus somni One-Step PCR kit

Sign In for Pricing
View Details
HOXC6 (NM_153693) Human 3' UTR Clone
SC210547 10 µg

HOXC6 (NM_153693) Human 3' UTR Clone

Sign In for Pricing
View Details
Caspase 8, CT (CASP8, CASP-8, ALPS2B, Apoptotic Cysteine Protease, Apoptotic Protease Mch-5, CAP4, FADD-homologous ICE/ced-3-like Protease, FADD-like ICE, FLICE, FLJ17672, ICE-like Apoptotic Protease 5, MORT1-associated Ced-3 Homolog, MACH, MCH5, MGC78473
MBS6467571-01 0.2 mL

Caspase 8, CT (CASP8, CASP-8, ALPS2B, Apoptotic Cysteine Protease, Apoptotic Protease Mch-5, CAP4, FADD-homologous ICE/ced-3-like Protease, FADD-like ICE, FLICE, FLJ17672, ICE-like Apoptotic Protease 5, MORT1-associated Ced-3 Homolog, MACH, MCH5, MGC78473

Sign In for Pricing
View Details
Caspase 8, CT (CASP8, CASP-8, ALPS2B, Apoptotic Cysteine Protease, Apoptotic Protease Mch-5, CAP4, FADD-homologous ICE/ced-3-like Protease, FADD-like ICE, FLICE, FLJ17672, ICE-like Apoptotic Protease 5, MORT1-associated Ced-3 Homolog, MACH, MCH5, MGC78473
MBS6467571-02 5x 0.2 mL

Caspase 8, CT (CASP8, CASP-8, ALPS2B, Apoptotic Cysteine Protease, Apoptotic Protease Mch-5, CAP4, FADD-homologous ICE/ced-3-like Protease, FADD-like ICE, FLICE, FLJ17672, ICE-like Apoptotic Protease 5, MORT1-associated Ced-3 Homolog, MACH, MCH5, MGC78473

Sign In for Pricing
View Details