Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig phosphatidyl ethanol (PEth) ELISA Kit
MBS2602538-01 48 Well

Guinea pig phosphatidyl ethanol (PEth) ELISA Kit

Sign In for Pricing
View Details
Guinea pig phosphatidyl ethanol (PEth) ELISA Kit
MBS2602538-02 96 Well

Guinea pig phosphatidyl ethanol (PEth) ELISA Kit

Sign In for Pricing
View Details
Guinea pig phosphatidyl ethanol (PEth) ELISA Kit
MBS2602538-03 5x 96 Well

Guinea pig phosphatidyl ethanol (PEth) ELISA Kit

Sign In for Pricing
View Details
Guinea pig phosphatidyl ethanol (PEth) ELISA Kit
MBS2602538-04 10x 96 Well

Guinea pig phosphatidyl ethanol (PEth) ELISA Kit

Sign In for Pricing
View Details
Mouse Cep85l Pre-designed siRNA Set A
SI102399A 1 Each

Mouse Cep85l Pre-designed siRNA Set A

Sign In for Pricing
View Details
S100A10 (NM_002966) Human Tagged Lenti ORF Clone
RC204992L1 10 µg

S100A10 (NM_002966) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details