Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R-VLPs, Mouse (HEK293, His)

MC1R-VLPs Protein, Mouse (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

MC1R-VLPs Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mc1r-vlps-protein-mouse-hek293-his.html

Smiles

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Molecular Formula

17199 (Gene_ID) Q01727 (M1-W315) (Accession)

Molecular Weight

36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Myelin Basic Protein (MBP) ELISA Kit
abx358179 96 Well

Guinea pig Myelin Basic Protein (MBP) ELISA Kit

Sign In for Pricing
View Details
Dulcoside A (13CD2)
TRC-D720519-5MG 5 mg

Dulcoside A (13CD2)

Sign In for Pricing
View Details
Rat Collagen Alpha-1 III Chain (COL3A1) ELISA Kit
abx573368-01 96 Tests

Rat Collagen Alpha-1 III Chain (COL3A1) ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Alpha-1 III Chain (COL3A1) ELISA Kit
abx573368-02 5x 96 Tests

Rat Collagen Alpha-1 III Chain (COL3A1) ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Alpha-1 III Chain (COL3A1) ELISA Kit
abx573368-03 10x 96 Tests

Rat Collagen Alpha-1 III Chain (COL3A1) ELISA Kit

Sign In for Pricing
View Details
Camel Pancreas/Duodenum Homeobox Protein 1 (PDX1) ELISA Kit
MBS9346770-01 48 Well

Camel Pancreas/Duodenum Homeobox Protein 1 (PDX1) ELISA Kit

Sign In for Pricing
View Details