Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-17A (Il17a), partial (Active)

Product Specifications

Product Name Alternative

Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17

Abbreviation

Recombinant Mouse Il17a protein, partial (Active)

Gene Name

Il17a

UniProt

Q62386

Expression Region

22-158aa

Organism

Mus musculus (Mouse)

Target Sequence

TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. Mature mouse IL-17A shares 61% and 89% amino acid sequence identity with human and rat IL-17A, respectively. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells is 0.25-1.25 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, PH7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand for IL17RA

Molecular Weight

16.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Metabotropic Glutamate Receptor 3 Rabbit Monoclonal Antibody
MA3691-.1 100 µL

Anti-Metabotropic Glutamate Receptor 3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DIO2 Human Pre-designed siRNA Set A
HY-RS03770 1 Set

DIO2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Borrelia hermsii Phenylalanine--tRNA ligase beta subunit (pheT), partial
MBS1027660 Inquire

Recombinant Borrelia hermsii Phenylalanine--tRNA ligase beta subunit (pheT), partial

Sign In for Pricing
View Details
Anti-FOLH1 / PSMA (Prostate Epithelial Marker) Monoclonal Antibody (Clone: FOLH1/2354)
36-2316-20 20 µg

Anti-FOLH1 / PSMA (Prostate Epithelial Marker) Monoclonal Antibody (Clone: FOLH1/2354)

Sign In for Pricing
View Details
Lentiviral human AMBRA1 shRNA (UAS) - Lentiviral human AMBRA1 shRNA (UAS, RFP) (100)
GTR15123888 1 Vial

Lentiviral human AMBRA1 shRNA (UAS) - Lentiviral human AMBRA1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
FSCN1 Polyclonal Conjugated Antibody
MBS9441577-01 0.1 mL (Biotin)

FSCN1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details