Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Human (CHO, His)

FGF-21 Protein, Human (CHO, His) is a polypeptide chain containing the C-termimal His tag produced in CHO cells.FGF-21 Protein, Human (CHO, His) is a member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Product Specifications

Product Name Alternative

FGF-21 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-human-cho-his.html

Purity

98.0

Smiles

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYASHHHHHH

Molecular Formula

26291 (Gene_ID) Q9NSA1 (H29-S209) (Accession)

Molecular Weight

Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Cao F, et al. Fibroblast growth factor 21 attenuates calcification of vascular smooth muscle cells in vitro. J Pharm Pharmacol. 2017 Dec;69 (12) :1802-1816.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0652 (ATG13) Rabbit Polyclonal Antibody
TA397436S 25 µL

KIAA0652 (ATG13) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human SULT2B1 Protein (His Tag)
PKSH033369-01 10 µg

Recombinant Human SULT2B1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SULT2B1 Protein (His Tag)
PKSH033369-02 50 µg

Recombinant Human SULT2B1 Protein (His Tag)

Sign In for Pricing
View Details
Virginiamycin(>85%)
TRC-V673800-2.5MG 2.5 mg

Virginiamycin(>85%)

Sign In for Pricing
View Details
Recombinant ARSA Antibody
RN-080-01 50 μL

Recombinant ARSA Antibody

Sign In for Pricing
View Details
Recombinant ARSA Antibody
RN-080-02 100 µL

Recombinant ARSA Antibody

Sign In for Pricing
View Details