Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Human (CHO, His)

FGF-21 Protein, Human (CHO, His) is a polypeptide chain containing the C-termimal His tag produced in CHO cells.FGF-21 Protein, Human (CHO, His) is a member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Product Specifications

Product Name Alternative

FGF-21 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-human-cho-his.html

Purity

98.0

Smiles

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYASHHHHHH

Molecular Formula

26291 (Gene_ID) Q9NSA1 (H29-S209) (Accession)

Molecular Weight

Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Cao F, et al. Fibroblast growth factor 21 attenuates calcification of vascular smooth muscle cells in vitro. J Pharm Pharmacol. 2017 Dec;69 (12) :1802-1816.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBGT1 Polyclonal Antibody
E-AB-19900-01 20 µL

GBGT1 Polyclonal Antibody

Sign In for Pricing
View Details
GBGT1 Polyclonal Antibody
E-AB-19900-02 60 µL

GBGT1 Polyclonal Antibody

Sign In for Pricing
View Details
GBGT1 Polyclonal Antibody
E-AB-19900-03 120 µL

GBGT1 Polyclonal Antibody

Sign In for Pricing
View Details
GBGT1 Polyclonal Antibody
E-AB-19900-04 200 µL

GBGT1 Polyclonal Antibody

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-100 1x 100 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DPH5 (NM_015958) Human Recombinant Protein
TP320529M 100 µg

DPH5 (NM_015958) Human Recombinant Protein

Sign In for Pricing
View Details