Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Human (CHO, His)

FGF-21 Protein, Human (CHO, His) is a polypeptide chain containing the C-termimal His tag produced in CHO cells.FGF-21 Protein, Human (CHO, His) is a member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Product Specifications

Product Name Alternative

FGF-21 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-human-cho-his.html

Purity

98.0

Smiles

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYASHHHHHH

Molecular Formula

26291 (Gene_ID) Q9NSA1 (H29-S209) (Accession)

Molecular Weight

Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Cao F, et al. Fibroblast growth factor 21 attenuates calcification of vascular smooth muscle cells in vitro. J Pharm Pharmacol. 2017 Dec;69 (12) :1802-1816.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3347), Biotin conjugate, 0.1mg/mL
BNCB3347-500 1x 500 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3347), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR561356 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
PEDS1 (NM_199129) Human Recombinant Protein
TP324011 20 µg

PEDS1 (NM_199129) Human Recombinant Protein

Sign In for Pricing
View Details
CD32 (Fc Gamma RIIa) (FCGR2A/479), CF488A conjugate, 0.1mg/mL
BNC880479-500 1x 500 µL

CD32 (Fc Gamma RIIa) (FCGR2A/479), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-(4-Aminophenyl)-1,3,4-oxadiazol-2-ol
TRC-A616008-10MG 10 mg

5-(4-Aminophenyl)-1,3,4-oxadiazol-2-ol

Sign In for Pricing
View Details
TP53BP2 (N-term) Rabbit Polyclonal Antibody
AP54338PU-N 400 µL

TP53BP2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details