Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Human (CHO, His)

FGF-21 Protein, Human (CHO, His) is a polypeptide chain containing the C-termimal His tag produced in CHO cells.FGF-21 Protein, Human (CHO, His) is a member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Product Specifications

Product Name Alternative

FGF-21 Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-human-cho-his.html

Purity

98.0

Smiles

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYASHHHHHH

Molecular Formula

26291 (Gene_ID) Q9NSA1 (H29-S209) (Accession)

Molecular Weight

Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Cao F, et al. Fibroblast growth factor 21 attenuates calcification of vascular smooth muscle cells in vitro. J Pharm Pharmacol. 2017 Dec;69 (12) :1802-1816.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v4/5 (Marker of Tumor Metastasis) (3D2), CF568 conjugate, 0.1mg/mL
BNC683075-100 1x 100 µL

CD44v4/5 (Marker of Tumor Metastasis) (3D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR Human Gene Knockout Kit (CRISPR)
KN401163 1 Kit

AMACR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CREG1 activation kit by CRISPRa
GA105850 1 Kit

Human CREG1 activation kit by CRISPRa

Sign In for Pricing
View Details
Biglycan (BGN) Human Gene Knockout Kit (CRISPR)
KN200715 1 Kit

Biglycan (BGN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Galr3 activation kit by CRISPRa
GA201540 1 Kit

Mouse Galr3 activation kit by CRISPRa

Sign In for Pricing
View Details
3,4-Difluoro-1,5-dioxaspiro[5.5]undecan-2-one
TRC-D687830-250MG 250 mg

3,4-Difluoro-1,5-dioxaspiro[5.5]undecan-2-one

Sign In for Pricing
View Details