Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORD, Human (HEK293, His)

SORD Protein is an enzyme that in humans is encoded by the SORD gene. SPRD is a polyol dehydrogenase that catalyzes the reversible NAD+-dependent oxidation of various sugar alcohols. SPRD is a key enzyme in the polyol pathway that interconverts glucose and fructose via sorbitol, which constitutes an important alternate route for glucose metabolism. SORD Protein, Human (HEK293, His) is the recombinant human-derived SORD protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SORD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sord-protein-human-hek-293-his.html

Purity

98.0

Smiles

AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP

Molecular Formula

6652 (Gene_ID) AAH21085.1 (A2-P357) (Accession)

Molecular Weight

39 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRDMT1 Protein Vector (Human) (pPB-N-His)
PV137799 500 ng

TRDMT1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
2-Amino-2-methyl-1-propanol (AMP) discontinued. See 258363
229694-01 1 L

2-Amino-2-methyl-1-propanol (AMP) discontinued. See 258363

Sign In for Pricing
View Details
2-Amino-2-methyl-1-propanol (AMP) discontinued. See 258363
229694-02 2.5 L

2-Amino-2-methyl-1-propanol (AMP) discontinued. See 258363

Sign In for Pricing
View Details
2-Amino-2-methyl-1-propanol (AMP) discontinued. See 258363
229694-03 10 L

2-Amino-2-methyl-1-propanol (AMP) discontinued. See 258363

Sign In for Pricing
View Details
2-Amino-2-methyl-1-propanol (AMP) discontinued. See 258363
229694-04 25 L

2-Amino-2-methyl-1-propanol (AMP) discontinued. See 258363

Sign In for Pricing
View Details
RAB23 (Ras-related Protein Rab-23, HSPC137) (Biotin)
MBS6391684-01 0.1 mL

RAB23 (Ras-related Protein Rab-23, HSPC137) (Biotin)

Sign In for Pricing
View Details