Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Norrin, Human

Norrin protein activates canonical Wnt signaling by binding to FZD4 and LRP5, promotes retinal vascularization and stabilizes β-catenin (CTNNB1) . It cooperates with TSPAN12 to independently activate FZD4, suggesting a Wnt-independent mechanism. Norrin Protein, Human is the recombinant human-derived Norrin protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Norrin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/norrin-protein-human.html

Purity

96.0

Smiles

KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

Molecular Formula

4693 (Gene_ID) Q00604 (K25-S133) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Caspase-10 ELISA Kit
NSL0096Hu 96 Tests

Human Caspase-10 ELISA Kit

Ask
View Details
INPP5B (OCRL2, Type II Inositol 1,4,5-trisphosphate 5-phosphatase, 75kD Inositol Polyphosphate-5-phosphatase, Phosphoinositide 5-phosphatase, MGC65156, MGC71303) (MaxLight 490)
MBS6382965-01 0.1 mL

INPP5B (OCRL2, Type II Inositol 1,4,5-trisphosphate 5-phosphatase, 75kD Inositol Polyphosphate-5-phosphatase, Phosphoinositide 5-phosphatase, MGC65156, MGC71303) (MaxLight 490)

Ask
View Details
INPP5B (OCRL2, Type II Inositol 1,4,5-trisphosphate 5-phosphatase, 75kD Inositol Polyphosphate-5-phosphatase, Phosphoinositide 5-phosphatase, MGC65156, MGC71303) (MaxLight 490)
MBS6382965-02 5x 0.1 mL

INPP5B (OCRL2, Type II Inositol 1,4,5-trisphosphate 5-phosphatase, 75kD Inositol Polyphosphate-5-phosphatase, Phosphoinositide 5-phosphatase, MGC65156, MGC71303) (MaxLight 490)

Ask
View Details
LSM4 (LSM4 Homolog, U6 Small Nuclear RNA Associated (S. cerevisiae), YER112W) (MaxLight 405)
MBS6196548-01 0.1 mL

LSM4 (LSM4 Homolog, U6 Small Nuclear RNA Associated (S. cerevisiae), YER112W) (MaxLight 405)

Ask
View Details
LSM4 (LSM4 Homolog, U6 Small Nuclear RNA Associated (S. cerevisiae), YER112W) (MaxLight 405)
MBS6196548-02 5x 0.1 mL

LSM4 (LSM4 Homolog, U6 Small Nuclear RNA Associated (S. cerevisiae), YER112W) (MaxLight 405)

Ask
View Details
Recombinant Contactin Associated Protein Like Protein 3 (CNTNAP3)
SIPD319Hu01-01 10 µg

Recombinant Contactin Associated Protein Like Protein 3 (CNTNAP3)

Ask
View Details