Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Norrin, Human

Norrin protein activates canonical Wnt signaling by binding to FZD4 and LRP5, promotes retinal vascularization and stabilizes β-catenin (CTNNB1) . It cooperates with TSPAN12 to independently activate FZD4, suggesting a Wnt-independent mechanism. Norrin Protein, Human is the recombinant human-derived Norrin protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Norrin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/norrin-protein-human.html

Purity

96.0

Smiles

KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

Molecular Formula

4693 (Gene_ID) Q00604 (K25-S133) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-500 1x 500 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-500 1x 500 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF740 conjugate, 0.1mg/mL
BNC740485-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5), CF647 conjugate, 0.1mg/mL
BNC470167-500 1x 500 µL

GFAP (GA-5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details