Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LIM and SH3 domain protein 1 (LASP1), partial

Product Specifications

Product Name Alternative

Metastatic lymph node gene 50 protein

Abbreviation

Recombinant Human LASP1 protein, partial

Gene Name

LASP1

UniProt

Q14847

Expression Region

1-243aa

Organism

Homo sapiens (Human)

Target Sequence

MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGT

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transport

Relevance

Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kif12 (BC022225) AAV Particle
MR205147A1V 250 µL

Mouse Kif12 (BC022225) AAV Particle

Sign In for Pricing
View Details
GOT2, NT (Glutamate Oxaloacetate Transaminase 2, Aspartate Aminotransferase Mitochondrial, Fatty Acid-binding Protein, FABP-1, FLJ40994, KAT4, KATIV, mAspAT, mitAAT, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A) (MaxLight 650) discontinued
G7122-01N-ML650 100 µL

GOT2, NT (Glutamate Oxaloacetate Transaminase 2, Aspartate Aminotransferase Mitochondrial, Fatty Acid-binding Protein, FABP-1, FLJ40994, KAT4, KATIV, mAspAT, mitAAT, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Fibroblast Growth Factor (FGF-19)
GWB-1BE08B 0.025 mg

Fibroblast Growth Factor (FGF-19)

Sign In for Pricing
View Details
Anti-VATG2 antibody
STJ191617 200 µl

Anti-VATG2 antibody

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 Alpha (MIP1a, CCL3, MIP1-A, SCYA3, Chemokine C-C-Motif Ligand 3, Small Inducible Cytokine A3, Homologous To Mouse Mip-1a) (APC) discontinued
141346-APC 100 µL

Macrophage Inflammatory Protein 1 Alpha (MIP1a, CCL3, MIP1-A, SCYA3, Chemokine C-C-Motif Ligand 3, Small Inducible Cytokine A3, Homologous To Mouse Mip-1a) (APC) discontinued

Sign In for Pricing
View Details
Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 650)
MBS6223463-01 0.1 mL

Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 650)

Sign In for Pricing
View Details