Animal-Free IP-10/CRG-2/CXCL10, Mouse (His)
The IP-10/CRG-2/CXCL10 protein is a proinflammatory cytokine that regulates immune cells, cell growth, apoptosis, and vasostatic effects. It is critical during viral infection by binding to CXCR3 to activate immune cells and migrate them to the site of infection. Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-ip-10-crg-2-cxcl10-protein-mouse-his.html
Purity
98.0
Smiles
IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Molecular Formula
15945 (Gene_ID) P17515 (I22-P98) (Accession)
Molecular Weight
Approximately 7-11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Human Defensin Beta 103A (DEFb103A) ELISA Kit
HOXD13 (Homeobox Protein Hox-D13, Homeobox Protein Hox-4I, HOX4I) (MaxLight 550)
Mouse Monoclonal CNPase Antibody (1H10) [DyLight 650]
