Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucose-6-phosphatase catalytic subunit 1 (G6PC1), partial

Product Specifications

Product Name Alternative

(Glucose-6-phosphatase) (G-6-Pase) (G6Pase) (Glucose-6-phosphatase alpha) (G6Pase-alpha)

Abbreviation

Recombinant Human G6PC1 protein, partial

Gene Name

G6PC1

UniProt

P35575

Expression Region

82-117aa

Organism

Homo sapiens (Human)

Target Sequence

QRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. Forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production in the terminal step of glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

5.6 kDa

References & Citations

"Identification of mutations in the glucose-6-phosphatase gene in Czech and Slovak patients with glycogen storage disease type Ia, including novel mutations K76N, V166A and 540del5." Kozak L., Francova H., Hrabincova E., Stastna S., Peskova K., Elleder M. Hum. Mutat. 16:89-89 (2000) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster oxidized lowdensity Lipoprotein, OX-LDL GENLISA ELISA
KLH0021 96 Well

Hamster oxidized lowdensity Lipoprotein, OX-LDL GENLISA ELISA

Sign In for Pricing
View Details
SRRM3 Human shRNA Lentiviral Particle (Locus ID 222183)
TL319646V 500 µL Each

SRRM3 Human shRNA Lentiviral Particle (Locus ID 222183)

Sign In for Pricing
View Details
Rabbit Polyclonal SCD-1 Antibody [CoraFluor 1]
NBP1-26393CL1 0.1 mL

Rabbit Polyclonal SCD-1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
CHAD Polyclonal Conjugated Antibody
MBS9440392-01 0.1 mL (Biotin)

CHAD Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
CHAD Polyclonal Conjugated Antibody
MBS9440392-02 0.1 mL (AF350)

CHAD Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
CHAD Polyclonal Conjugated Antibody
MBS9440392-03 0.1 mL (AF405)

CHAD Polyclonal Conjugated Antibody

Sign In for Pricing
View Details