CD276/B7-H3, Human (HEK293, Fc)
CD276/B7-H3 Protein, Human (HEK293, Fc) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. B7-H3 is an immune checkpoint from the B7 family of molecules.
Product Specifications
Product Name Alternative
CD276/B7-H3 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-h3-icoslg-protein-human-hek293-fc.html
Purity
95.0
Smiles
HLEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Molecular Formula
80381 (Gene_ID) Q5ZPR3-2 (L29-P245) (Accession)
Molecular Weight
62-65 kDa
References & Citations
[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880460-500 1x 500 µL
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470030-500 1x 500 µL
Insulin (2D11-H5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940012-500 1x 500 µL
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041203-100 1x 100 µL
Smooth Muscle Actin (ACTA2/791 +1A4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details