Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD276/B7-H3, Human (HEK293, Fc)

CD276/B7-H3 Protein, Human (HEK293, Fc) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. B7-H3 is an immune checkpoint from the B7 family of molecules.

Product Specifications

Product Name Alternative

CD276/B7-H3 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h3-icoslg-protein-human-hek293-fc.html

Purity

95.0

Smiles

HLEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

Molecular Formula

80381 (Gene_ID) Q5ZPR3-2 (L29-P245) (Accession)

Molecular Weight

62-65 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAM68 Recombinant Antibody, APC Conjugated
bsm-62865R-APC-TR 20 µL

SAM68 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Aldose Reductase rabbit pAb
ES1641-01 50 µL

Aldose Reductase rabbit pAb

Sign In for Pricing
View Details
Aldose Reductase rabbit pAb
ES1641-02 100 µL

Aldose Reductase rabbit pAb

Sign In for Pricing
View Details
Dgat2 Rat shRNA Lentiviral Particle (Locus ID 252900)
TL701741V 500 µL Each

Dgat2 Rat shRNA Lentiviral Particle (Locus ID 252900)

Sign In for Pricing
View Details
Recombinant Bovine Hepatocyte growth factor receptor (MET) , partial
MBS1305840 Inquire

Recombinant Bovine Hepatocyte growth factor receptor (MET) , partial

Sign In for Pricing
View Details
OR7E104P CRISPRa sgRNA lentivector (set of three targets)(Human)
35556121 3x 1.0µg DNA

OR7E104P CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details