Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Camelpox virus A27L membrane protein (A27L)

Product Specifications

Abbreviation

Recombinant Camelpox virus A27L protein

Gene Name

A27L

UniProt

C9E791

Expression Region

1-110aa

Organism

Camelpox virus (GUP)

Target Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIIKADGDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Thyroid gland
CS701589 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
FITC Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994UC-01 25 µg

FITC Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994UC-02 100 µg

FITC Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
EnzyChrom™ Alanine Transaminase Assay Kit
EALT-100 100 Tests

EnzyChrom™ Alanine Transaminase Assay Kit

Sign In for Pricing
View Details
Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D3]
TA805085BM 100 µL

Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D3]

Sign In for Pricing
View Details
CLPTM1L (C-term) Rabbit Polyclonal Antibody
AP50975PU-N 400 µL

CLPTM1L (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details