Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPYSL2, Human (P.pastoris, His)

DPYSL2 protein plays a crucial role in neuronal development, polarity, axon growth, guidance, growth cone collapse, and cell migration. It is essential for signaling by class 3 semaphorins and cytoskeleton remodeling. DPYSL2 forms homotetramers and heterotetramers with CRMP1, DPYSL3, DPYSL4, or DPYSL5. It interacts with CYFIP1/SRA1, HTR4, CLN6, and MICALL1, highlighting its diverse functions and interactions in cellular processes. DPYSL2 Protein, Human (P.pastoris, His) is the recombinant human-derived DPYSL2 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

DPYSL2 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dpysl2-protein-human-p-pastoris-his.html

Purity

93.0

Smiles

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

Molecular Formula

1808 (Gene_ID) Q16555 (M1-G572) (Accession)

Molecular Weight

Approximately 64 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human A Disintegrin And Metalloprotease 17 (ADAM17) ELISA Kit
RD-ADAM17-Hu-01 96 Tests

Human A Disintegrin And Metalloprotease 17 (ADAM17) ELISA Kit

Ask
View Details
Human A Disintegrin And Metalloprotease 17 (ADAM17) ELISA Kit
RD-ADAM17-Hu-02 48 Tests

Human A Disintegrin And Metalloprotease 17 (ADAM17) ELISA Kit

Ask
View Details
Rabbit Glucosamine-6-Phosphate Isomerase 1 (GNPDA1) ELISA Kit
MBS7256915-01 48 Well

Rabbit Glucosamine-6-Phosphate Isomerase 1 (GNPDA1) ELISA Kit

Ask
View Details
Rabbit Glucosamine-6-Phosphate Isomerase 1 (GNPDA1) ELISA Kit
MBS7256915-02 96 Well

Rabbit Glucosamine-6-Phosphate Isomerase 1 (GNPDA1) ELISA Kit

Ask
View Details
Rabbit Glucosamine-6-Phosphate Isomerase 1 (GNPDA1) ELISA Kit
MBS7256915-03 5x 96 Well

Rabbit Glucosamine-6-Phosphate Isomerase 1 (GNPDA1) ELISA Kit

Ask
View Details
Rabbit Glucosamine-6-Phosphate Isomerase 1 (GNPDA1) ELISA Kit
MBS7256915-04 10x 96 Well

Rabbit Glucosamine-6-Phosphate Isomerase 1 (GNPDA1) ELISA Kit

Ask
View Details