Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae o-succinylbenzoate synthase (menC)

Product Specifications

CAS Number

9000-83-3

Gene Name

[menC]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[menC; OSB synthase; OSBS]

Short Name

[o-succinylbenzoate synthase (menC)]

Other Product Names

[o-succinylbenzoate synthase; o-succinylbenzoate synthase; 4-(2'-carboxyphenyl)-4-oxybutyric acid synthase]

NCBI GI Number

447178316

NCBI Accession Number

WP_001255572.1

NCBI GB Accession Number

WP_001255572.1

Uniprot Accession Number

A9MJB9

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Kallikrein 13 (KLK13) (NM_015596) Human Over-expression Lysate
LC414444 20 µg

Kallikrein 13 (KLK13) (NM_015596) Human Over-expression Lysate

Ask
View Details
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
MBS5818107 Inquire

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Ask
View Details
Mouse Glutamic Acid Decarboxylase Autoantibody GAD-Ab ELISA Kit
BG-MUS11130 1 Each

Mouse Glutamic Acid Decarboxylase Autoantibody GAD-Ab ELISA Kit

Ask
View Details
BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X Protein, ETK, Epithelial and Endothelial Tyrosine Kinase, NTK38) (HRP)
MBS6151447-01 0.1 mL

BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X Protein, ETK, Epithelial and Endothelial Tyrosine Kinase, NTK38) (HRP)

Ask
View Details
BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X Protein, ETK, Epithelial and Endothelial Tyrosine Kinase, NTK38) (HRP)
MBS6151447-02 5x 0.1 mL

BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X Protein, ETK, Epithelial and Endothelial Tyrosine Kinase, NTK38) (HRP)

Ask
View Details