Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKLR Antibody / Pyruvate kinase isozymes L/R

Pyruvate kinase isozymes L/R is an enzyme that in humans is encoded by the PKLR gene. It is mapped to 1q21. The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA) . Multiple transcript variants encoding different isoforms have been found for this gene.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL

UniProt

P30613

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids EAIWADDVDRRVQFGIESGKLRGFLRVGDLV of human PKLR were used as the immunogen for the PKLR antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the PKLR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This PKLR antibody is available for research use only.

Storage Conditions

After reconstitution, the PKLR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the PKLR antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

IHC testing of FFPE human intestinal cancer with PKLR antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Sartorius Membrane MGB 47mm
SAR4210 50 / PCK

Sartorius Membrane MGB 47mm

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 3, C1QTNF3 ELISA Kit
MBS1604826-01 48 Well

Mouse Complement C1q tumor necrosis factor-related protein 3, C1QTNF3 ELISA Kit

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 3, C1QTNF3 ELISA Kit
MBS1604826-02 96 Well

Mouse Complement C1q tumor necrosis factor-related protein 3, C1QTNF3 ELISA Kit

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 3, C1QTNF3 ELISA Kit
MBS1604826-03 5x 96 Well

Mouse Complement C1q tumor necrosis factor-related protein 3, C1QTNF3 ELISA Kit

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 3, C1QTNF3 ELISA Kit
MBS1604826-04 10x 96 Well

Mouse Complement C1q tumor necrosis factor-related protein 3, C1QTNF3 ELISA Kit

Sign In for Pricing
View Details
Rbp3 ORF Vector (Mouse) (pORF)
ORF055771 1.0 µg DNA

Rbp3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details