BTLA/CD272, Human (HEK293, hFc)
The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-hFc, C-Myc labeled tag.
Product Specifications
Product Name Alternative
BTLA/CD272 Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/btla-protein-human-hek-293-hfc-myc.html
Smiles
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Molecular Formula
151888 (Gene_ID) Q7Z6A9-1 (K31-S150) (Accession)
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
