Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A2, Human (Biotinylated, HEK293, His-Avi)

BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a2-protein-human-hek-293-his-avi.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Molecular Formula

11118 (Gene_ID) P78410-1 (Q30-W248) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIOX Protein Vector (Human) (pPB-C-His)
PV025989 500 ng

MIOX Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Tgm7 shRNA (UAS) - Lentiviral mouseTgm7 shRNA (UAS, GFP) (25)
GTR15158408 1 Vial

Lentiviral mouse Tgm7 shRNA (UAS) - Lentiviral mouseTgm7 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
KCNH8 Polyclonal Antibody
RD78535A-01 20 µL

KCNH8 Polyclonal Antibody

Sign In for Pricing
View Details
KCNH8 Polyclonal Antibody
RD78535A-02 60 μL

KCNH8 Polyclonal Antibody

Sign In for Pricing
View Details
KCNH8 Polyclonal Antibody
RD78535A-03 120 μL

KCNH8 Polyclonal Antibody

Sign In for Pricing
View Details
KCNH8 Polyclonal Antibody
RD78535A-04 200 µL

KCNH8 Polyclonal Antibody

Sign In for Pricing
View Details