BTN3A2, Human (Biotinylated, HEK293, His-Avi)
BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Product Specifications
Product Name Alternative
BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/btn3a2-protein-human-hek-293-his-avi.html
Smiles
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Molecular Formula
11118 (Gene_ID) P78410-1 (Q30-W248) (Accession)
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal Adenovirus Hexon Antibody (1431 (2C4)) [Alexa Fluor 405]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NB100-62300AF405 0.1 mL
Mouse Monoclonal Adenovirus Hexon Antibody (1431 (2C4)) [Alexa Fluor 405]
Sign In for Pricing
View Details 
MBS1031460-01 0.05 mg (E-Coli)
Recombinant Thr operon leader peptide (thrL)
Sign In for Pricing
View Details MBS1031460-02 0.2 mg (E-Coli)
Recombinant Thr operon leader peptide (thrL)
Sign In for Pricing
View Details MBS1031460-03 0.5 mg (E-Coli)
Recombinant Thr operon leader peptide (thrL)
Sign In for Pricing
View Details 
MBS1031460-04 0.05 mg (Yeast)
Recombinant Thr operon leader peptide (thrL)
Sign In for Pricing
View Details