BTN3A2, Human (Biotinylated, HEK293, His-Avi)
BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Product Specifications
Product Name Alternative
BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/btn3a2-protein-human-hek-293-his-avi.html
Smiles
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Molecular Formula
11118 (Gene_ID) P78410-1 (Q30-W248) (Accession)
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7080045 Inquire
Recombinant Eucalyptus globulus subsp. globulus Photosystem II CP43 chlorophyll apoprotein (psbC), partial
Sign In for Pricing
View Details 
TA320496 25 µg
Mouse Anti-Human/Mouse CD266 (TWEAK Receptor) Purified (25 ug)
Sign In for Pricing
View Details NBP2-98648AF350 0.1 mL
Rabbit Polyclonal PILR-beta Antibody [Alexa Fluor 350]
Sign In for Pricing
View Details