BTN3A2, Human (Biotinylated, HEK293, His-Avi)
BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Product Specifications
Product Name Alternative
BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/btn3a2-protein-human-hek-293-his-avi.html
Smiles
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Molecular Formula
11118 (Gene_ID) P78410-1 (Q30-W248) (Accession)
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx213897-01 50 µL
Sodium Voltage-Gated Channel Beta Subunit 1 (SCN1B) Antibody
Sign In for Pricing
View Details abx213897-02 100 µL
Sodium Voltage-Gated Channel Beta Subunit 1 (SCN1B) Antibody
Sign In for Pricing
View Details NBP2-97254AF532 0.1 mL
Rabbit Polyclonal DAO Antibody [Alexa Fluor 532]
Sign In for Pricing
View Details