Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A2, Human (Biotinylated, HEK293, His-Avi)

BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a2-protein-human-hek-293-his-avi.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Molecular Formula

11118 (Gene_ID) P78410-1 (Q30-W248) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC4A2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV715087 1.0 µg DNA

SLC4A2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
HNF-4α/γ Rabbit Polyclonal Antibody
ES3848-01 50 µL

HNF-4α/γ Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HNF-4α/γ Rabbit Polyclonal Antibody
ES3848-02 100 µL

HNF-4α/γ Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAPPC9 sgRNA CRISPR Lentivector set (Human)
K2442001 3x 1.0 µg

TRAPPC9 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Cdc16 Mouse siRNA Oligo Duplex (Locus ID 69957)
SR418293 1 Kit

Cdc16 Mouse siRNA Oligo Duplex (Locus ID 69957)

Sign In for Pricing
View Details
Chelidonic acid 100mg
A22579-100 100 mg

Chelidonic acid 100mg

Sign In for Pricing
View Details