Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A2, Human (Biotinylated, HEK293, His-Avi)

BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a2-protein-human-hek-293-his-avi.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Molecular Formula

11118 (Gene_ID) P78410-1 (Q30-W248) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sorting Nexin-16 (SNX16) Antibody
abx432188 200 µL

Sorting Nexin-16 (SNX16) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 775 (ZNF775) Antibody
abx030982-01 80 µL

Zinc Finger Protein 775 (ZNF775) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 775 (ZNF775) Antibody
abx030982-02 400 µL

Zinc Finger Protein 775 (ZNF775) Antibody

Sign In for Pricing
View Details
Mouse Chromosome 7 Paint Probe
FMWCP-07 10 Tests

Mouse Chromosome 7 Paint Probe

Sign In for Pricing
View Details
Recombinant Human CDCP1 Protein, His-tagged
CDCP1-42H- 10 µg

Recombinant Human CDCP1 Protein, His-tagged

Sign In for Pricing
View Details
AIM1L Polyclonal Antibody, APC Conjugated
bs-9093R-APC 100 µL

AIM1L Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details