Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A2, Human (Biotinylated, HEK293, His-Avi)

BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a2-protein-human-hek-293-his-avi.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Molecular Formula

11118 (Gene_ID) P78410-1 (Q30-W248) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSCAN1 Rabbit pAb
MBS9145687-01 0.02 mL

ZSCAN1 Rabbit pAb

Sign In for Pricing
View Details
ZSCAN1 Rabbit pAb
MBS9145687-02 0.1 mL

ZSCAN1 Rabbit pAb

Sign In for Pricing
View Details
ZSCAN1 Rabbit pAb
MBS9145687-03 5x 0.1 mL

ZSCAN1 Rabbit pAb

Sign In for Pricing
View Details
Recombinant p63 Antibody
RC-16771-01 50 μL

Recombinant p63 Antibody

Sign In for Pricing
View Details
Recombinant p63 Antibody
RC-16771-02 100 µL

Recombinant p63 Antibody

Sign In for Pricing
View Details
Recombinant p63 Antibody
RC-16771-03 1 mL

Recombinant p63 Antibody

Sign In for Pricing
View Details