Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A2, Human (Biotinylated, HEK293, His-Avi)

BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a2-protein-human-hek-293-his-avi.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Molecular Formula

11118 (Gene_ID) P78410-1 (Q30-W248) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCRT2 antibody
MBS5301358-01 0.1 mL

SCRT2 antibody

Sign In for Pricing
View Details
SCRT2 antibody
MBS5301358-02 5x 0.1 mL

SCRT2 antibody

Sign In for Pricing
View Details
Mouse Monoclonal Dengue Virus NS5 Antibody (02) [Alexa Fluor 700]
NBP3-30750AF700 0.1 mL

Mouse Monoclonal Dengue Virus NS5 Antibody (02) [Alexa Fluor 700]

Sign In for Pricing
View Details
SPTAN1 Antibody
ABD8043 100 µg

SPTAN1 Antibody

Sign In for Pricing
View Details
BTBD7 (NM_001002860) Human Tagged ORF Clone Lentiviral Particle
RC213778L4V 200 µL

BTBD7 (NM_001002860) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
OR2C1 antibody
70R-35718 100 ug

OR2C1 antibody

Sign In for Pricing
View Details