Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kit ligand (KITLG), partial (Active)

Product Specifications

Product Name Alternative

Kit ligand; Mast cell growth factor; Stem cell factor; c-Kit ligand; Soluble KIT ligand

Abbreviation

Recombinant Human KITLG protein, partial (Active)

Gene Name

KITLG

UniProt

P21583

Expression Region

26-189aa

Organism

Homo sapiens (Human)

Target Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 1.813-3.203 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.8 kDa

References & Citations

The full-ORF clone resource of the German cDNA consortium. Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Schupp I. BMC Genomics 8:399-399 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CCRL2 (Chemokine (C-C Motif) Receptor-like 2, CKRX, CRAM-A, CRAM-B, FLJ55815, HCR, MGC116710)
244337 100 µg

CCRL2 (Chemokine (C-C Motif) Receptor-like 2, CKRX, CRAM-A, CRAM-B, FLJ55815, HCR, MGC116710)

Ask
View Details
Mouse Monoclonal Integrin alpha 2b/CD41 Antibody (M148) [CoraFluor 1]
NB100-2614CL1 0.1 mL

Mouse Monoclonal Integrin alpha 2b/CD41 Antibody (M148) [CoraFluor 1]

Ask
View Details
Rabbit Polyclonal NAP1L3 Antibody
H00004675-D01P 0.1 mg

Rabbit Polyclonal NAP1L3 Antibody

Ask
View Details
SHC (SHC1) pSer36 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 6E10]
AM00144PU-N 100 µg

SHC (SHC1) pSer36 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 6E10]

Ask
View Details
Mouse General Transcription Factor IIF, Polypeptide 1 ELISA Kit
MBS724270-01 48 Well

Mouse General Transcription Factor IIF, Polypeptide 1 ELISA Kit

Ask
View Details
Mouse General Transcription Factor IIF, Polypeptide 1 ELISA Kit
MBS724270-02 96 Well

Mouse General Transcription Factor IIF, Polypeptide 1 ELISA Kit

Ask
View Details