Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphA7, Mouse (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5) . It affects brain development by regulating intercellular adhesion and repulsion, contributing to axonal guidance of corticothalamic and retinal axons. EphA7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EphA7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha7-protein-mouse-hek293-his.html

Purity

98.0

Smiles

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVI

Molecular Formula

13841 (Gene_ID) Q61772 (Q28-I556) (Accession)

Molecular Weight

Approximately 68-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD11c Monoclonal Antibody (PE Conjugated)
MBS2553994-01 20 Tests

Anti-Human CD11c Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details
Anti-Human CD11c Monoclonal Antibody (PE Conjugated)
MBS2553994-02 100 Tests

Anti-Human CD11c Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details
Anti-Human CD11c Monoclonal Antibody (PE Conjugated)
MBS2553994-03 2x 100 Tests

Anti-Human CD11c Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details
Anti-Human CD11c Monoclonal Antibody (PE Conjugated)
MBS2553994-04 10x 100 Tests

Anti-Human CD11c Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details
Wdr35 (NM_001159527) Mouse Tagged Lenti ORF Clone
MR217913L4 10 µg

Wdr35 (NM_001159527) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Camel Tubulin Polymerization Promoting Protein ELISA Kit
MBS082534-01 48 Well

Camel Tubulin Polymerization Promoting Protein ELISA Kit

Sign In for Pricing
View Details