Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphA7, Mouse (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5) . It affects brain development by regulating intercellular adhesion and repulsion, contributing to axonal guidance of corticothalamic and retinal axons. EphA7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EphA7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha7-protein-mouse-hek293-his.html

Purity

98.0

Smiles

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVI

Molecular Formula

13841 (Gene_ID) Q61772 (Q28-I556) (Accession)

Molecular Weight

Approximately 68-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pOTB7-APEX1 Plasmid
PVT18435 2 µg

pOTB7-APEX1 Plasmid

Sign In for Pricing
View Details
ILF2 (Interleukin Enhancer-binding Factor 2, Nuclear Factor of Activated T-cells 45kD, NF45, PRO3063) (HRP)
MBS6422617-01 0.1 mL

ILF2 (Interleukin Enhancer-binding Factor 2, Nuclear Factor of Activated T-cells 45kD, NF45, PRO3063) (HRP)

Sign In for Pricing
View Details
ILF2 (Interleukin Enhancer-binding Factor 2, Nuclear Factor of Activated T-cells 45kD, NF45, PRO3063) (HRP)
MBS6422617-02 5x 0.1 mL

ILF2 (Interleukin Enhancer-binding Factor 2, Nuclear Factor of Activated T-cells 45kD, NF45, PRO3063) (HRP)

Sign In for Pricing
View Details
Recombinant Human CD103 protein
TD-ATMP00296HU 50 µg

Recombinant Human CD103 protein

Sign In for Pricing
View Details
Sheep Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit
MBS747582-01 48 Well

Sheep Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit

Sign In for Pricing
View Details
Sheep Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit
MBS747582-02 96 Well

Sheep Neurotrophic Tyrosine Kinase Receptor Type 3 ELISA Kit

Sign In for Pricing
View Details