Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphA7, Mouse (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5) . It affects brain development by regulating intercellular adhesion and repulsion, contributing to axonal guidance of corticothalamic and retinal axons. EphA7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EphA7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha7-protein-mouse-hek293-his.html

Purity

98.0

Smiles

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVI

Molecular Formula

13841 (Gene_ID) Q61772 (Q28-I556) (Accession)

Molecular Weight

Approximately 68-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB9 Rabbit Monoclonal Antibody [Clone ID: 24GB90]
TA424999 100 µL

NDUFB9 Rabbit Monoclonal Antibody [Clone ID: 24GB90]

Sign In for Pricing
View Details
LIFR Protein Vector (Mouse) (pPM-C-His)
PV196593 500 ng

LIFR Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
LRRN3 sgRNA CRISPR Lentivector (Human) (Target 2)
K1239203 1.0 µg DNA

LRRN3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PCP-BSA Antigen (Capture)
SMAG3311 1 mg

PCP-BSA Antigen (Capture)

Sign In for Pricing
View Details
Anti-Galectin 1 Rabbit Monoclonal Antibody
MA2744-.05 50 µL

Anti-Galectin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rat Alpha-Fetoprotein Lens Culinaris Agglutinin 3 (AFPL3) ELISA Kit
abx256696-01 96 Tests

Rat Alpha-Fetoprotein Lens Culinaris Agglutinin 3 (AFPL3) ELISA Kit

Sign In for Pricing
View Details