Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphA7, Mouse (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5) . It affects brain development by regulating intercellular adhesion and repulsion, contributing to axonal guidance of corticothalamic and retinal axons. EphA7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EphA7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha7-protein-mouse-hek293-his.html

Purity

98.0

Smiles

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVI

Molecular Formula

13841 (Gene_ID) Q61772 (Q28-I556) (Accession)

Molecular Weight

Approximately 68-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCAA1 rabbit pAb
ES1789-01 50 µL

BRCAA1 rabbit pAb

Sign In for Pricing
View Details
BRCAA1 rabbit pAb
ES1789-02 100 µL

BRCAA1 rabbit pAb

Sign In for Pricing
View Details
KITH_HHV23 Rabbit Polyclonal Antibody
BT-AP03285-01 20 µL

KITH_HHV23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KITH_HHV23 Rabbit Polyclonal Antibody
BT-AP03285-02 50 µL

KITH_HHV23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KITH_HHV23 Rabbit Polyclonal Antibody
BT-AP03285-03 100 µL

KITH_HHV23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal NCAM-1/CD56 Antibody (1006429) [Janelia Fluor 585]
FAB24082JF585 0.1 mL

Mouse Monoclonal NCAM-1/CD56 Antibody (1006429) [Janelia Fluor 585]

Sign In for Pricing
View Details