Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphA7, Mouse (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5) . It affects brain development by regulating intercellular adhesion and repulsion, contributing to axonal guidance of corticothalamic and retinal axons. EphA7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EphA7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha7-protein-mouse-hek293-his.html

Purity

98.0

Smiles

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVI

Molecular Formula

13841 (Gene_ID) Q61772 (Q28-I556) (Accession)

Molecular Weight

Approximately 68-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl gallate
M19302-01 500 mg

Methyl gallate

Sign In for Pricing
View Details
Methyl gallate
M19302-02 1 g

Methyl gallate

Sign In for Pricing
View Details
Methyl gallate
M19302-03 1 mL x 10 mM in DMSO

Methyl gallate

Sign In for Pricing
View Details
CSNK2A3 (Casein Kinase II Subunit alpha 3, CK II alpha 3, Casein Kinase II alpha 1 Polypeptide Pseudogene, CSNK2A3, CSNK2A1P) (MaxLight 650) discontinued
302369-ML650 100 µL

CSNK2A3 (Casein Kinase II Subunit alpha 3, CK II alpha 3, Casein Kinase II alpha 1 Polypeptide Pseudogene, CSNK2A3, CSNK2A1P) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Fibroblast growth factor-binding protein 3 (Fgfbp3)
MBS1486823-01 0.02 mg (E-Coli)

Recombinant Mouse Fibroblast growth factor-binding protein 3 (Fgfbp3)

Sign In for Pricing
View Details
Recombinant Mouse Fibroblast growth factor-binding protein 3 (Fgfbp3)
MBS1486823-02 0.1 mg (E-Coli)

Recombinant Mouse Fibroblast growth factor-binding protein 3 (Fgfbp3)

Sign In for Pricing
View Details