Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphA7, Mouse (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5) . It affects brain development by regulating intercellular adhesion and repulsion, contributing to axonal guidance of corticothalamic and retinal axons. EphA7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EphA7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha7-protein-mouse-hek293-his.html

Purity

98.0

Smiles

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVI

Molecular Formula

13841 (Gene_ID) Q61772 (Q28-I556) (Accession)

Molecular Weight

Approximately 68-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Sox9b (zebrafish aa5-18) antibody
STJ72771 100 µg

Anti-Sox9b (zebrafish aa5-18) antibody

Sign In for Pricing
View Details
SFI1 Protein Vector (Human) (pPM-C-His)
PV057656 500 ng

SFI1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human SPSB2 Pre-designed siRNA Set B
SI015733B 1 Each

Human SPSB2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Monoclonal KIR2DS4/CD158i Antibody (5F2) [Alexa Fluor 700]
NBP1-04314AF700 0.1 mL

Mouse Monoclonal KIR2DS4/CD158i Antibody (5F2) [Alexa Fluor 700]

Sign In for Pricing
View Details
KRT16 (Keratin, Type I Cytoskeletal 16, Cytokeratin-16, CK-16, Keratin-16, K16, KRT16A) (FITC)
128935-FITC 100 µL

KRT16 (Keratin, Type I Cytoskeletal 16, Cytokeratin-16, CK-16, Keratin-16, K16, KRT16A) (FITC)

Sign In for Pricing
View Details
Rat Fractalkine (CX3CL1) ELISA Kit
abx155412-01 96 Tests

Rat Fractalkine (CX3CL1) ELISA Kit

Sign In for Pricing
View Details