Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphA7, Mouse (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5) . It affects brain development by regulating intercellular adhesion and repulsion, contributing to axonal guidance of corticothalamic and retinal axons. EphA7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EphA7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha7-protein-mouse-hek293-his.html

Purity

98.0

Smiles

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPVI

Molecular Formula

13841 (Gene_ID) Q61772 (Q28-I556) (Accession)

Molecular Weight

Approximately 68-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Znrf4 3'UTR Lenti-reporter-Luc Vector
51942084 1.0 µg

Znrf4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rabbit Polyclonal Rad17 Antibody [Alexa Fluor 750]
NB100-172AF750 0.1 mL

Rabbit Polyclonal Rad17 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Gene Mutation Detection Kit for Moderately to well differentiated adenocarcinoma (E(G719X);K(-) Mutation)
MLER-23 1 Kit

Gene Mutation Detection Kit for Moderately to well differentiated adenocarcinoma (E(G719X);K(-) Mutation)

Sign In for Pricing
View Details
Human CCDC14 Pre-designed siRNA Set A
SI002308A 1 Each

Human CCDC14 Pre-designed siRNA Set A

Sign In for Pricing
View Details
0610037L13Rik Recombinant Protein (Mouse)
RP109655 100 µg

0610037L13Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Human CK2h Protein, Untagged, E.coli-3ug
QP11434-3ug 3ug

Recombinant Human CK2h Protein, Untagged, E.coli-3ug

Sign In for Pricing
View Details