Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CDKN1A interacting zinc finger protein 1 (CIZ1) (NM_001131018) AAV Particle
RC226191A1V 250 µL

Human CDKN1A interacting zinc finger protein 1 (CIZ1) (NM_001131018) AAV Particle

Sign In for Pricing
View Details
PANX3 Rabbit Polyclonal Antibody (N-term)
E28PB1546 100 µL

PANX3 Rabbit Polyclonal Antibody (N-term)

Sign In for Pricing
View Details
Rat Granulin ELISA Kit
MBS722745-01 48 Well

Rat Granulin ELISA Kit

Sign In for Pricing
View Details
Rat Granulin ELISA Kit
MBS722745-02 96 Well

Rat Granulin ELISA Kit

Sign In for Pricing
View Details
Rat Granulin ELISA Kit
MBS722745-03 5x 96 Well

Rat Granulin ELISA Kit

Sign In for Pricing
View Details
Rat Granulin ELISA Kit
MBS722745-04 10x 96 Well

Rat Granulin ELISA Kit

Sign In for Pricing
View Details