Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENPP1, Control Peptide (Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 1, E-NPP 1, Membrane Component Chromosome 6 Surface Marker 1, Phosphodiesterase I/Nucleotide Pyrophosphatase 1, Plasma-cell Membrane Glycoprotein PC-1, M6S1, NPPS, PC1, PDNP1)
147892 100 µg

ENPP1, Control Peptide (Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 1, E-NPP 1, Membrane Component Chromosome 6 Surface Marker 1, Phosphodiesterase I/Nucleotide Pyrophosphatase 1, Plasma-cell Membrane Glycoprotein PC-1, M6S1, NPPS, PC1, PDNP1)

Sign In for Pricing
View Details
Nostrin sgRNA CRISPR Lentivector set (Mouse)
K3349701 3x 1.0 µg

Nostrin sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Lamin A/C Mouse Monoclonal Antibody
BF8125-01 100 µL

Lamin A/C Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Lamin A/C Mouse Monoclonal Antibody
BF8125-02 200 µL

Lamin A/C Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Porcine High Mobility Group Nucleosome Binding Domain 1 ELISA Kit
MBS022536-01 48 Well

Porcine High Mobility Group Nucleosome Binding Domain 1 ELISA Kit

Sign In for Pricing
View Details
Porcine High Mobility Group Nucleosome Binding Domain 1 ELISA Kit
MBS022536-02 96 Well

Porcine High Mobility Group Nucleosome Binding Domain 1 ELISA Kit

Sign In for Pricing
View Details