Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Glutathione S Transferase Pi (GSTp) Antibody Pair Kit (with Standard)
MBS2099912-01 5x 96 Tests

Porcine Glutathione S Transferase Pi (GSTp) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Glutathione S Transferase Pi (GSTp) Antibody Pair Kit (with Standard)
MBS2099912-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Porcine Glutathione S Transferase Pi (GSTp) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Glutathione S Transferase Pi (GSTp) Antibody Pair Kit (with Standard)
MBS2099912-03 10x 96 Tests

Porcine Glutathione S Transferase Pi (GSTp) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Glutathione S Transferase Pi (GSTp) Antibody Pair Kit (with Standard)
MBS2099912-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Porcine Glutathione S Transferase Pi (GSTp) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
RPL5P22 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV774885 1.0 µg DNA

RPL5P22 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Zebrafish TNFa (Tumor Necrosis Factor Alpha) ELISA Kit
EK247881 96 Well

Zebrafish TNFa (Tumor Necrosis Factor Alpha) ELISA Kit

Sign In for Pricing
View Details