Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vitamin B12-d3
HY-B0315S1 1 Each

Vitamin B12-d3

Sign In for Pricing
View Details
Carnmt1 (NM_001024974) Rat Tagged ORF Clone Lentiviral Particle
RR209754L4V 200 µL

Carnmt1 (NM_001024974) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SLC37A3 Human shRNA Plasmid Kit (Locus ID 84255)
TL301579 1 Kit

SLC37A3 Human shRNA Plasmid Kit (Locus ID 84255)

Sign In for Pricing
View Details
SLC26A10 (NM_133489) Human Tagged ORF Clone Lentiviral Particle
RC211984L4V 200 µL

SLC26A10 (NM_133489) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TPT1 (Tumor Protein, Translationally-controlled 1, FLJ27337, HRF, TCTP, p02) (PE)
MBS6185099-01 0.1 mL

TPT1 (Tumor Protein, Translationally-controlled 1, FLJ27337, HRF, TCTP, p02) (PE)

Sign In for Pricing
View Details
TPT1 (Tumor Protein, Translationally-controlled 1, FLJ27337, HRF, TCTP, p02) (PE)
MBS6185099-02 5x 0.1 mL

TPT1 (Tumor Protein, Translationally-controlled 1, FLJ27337, HRF, TCTP, p02) (PE)

Sign In for Pricing
View Details