Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Adora2a shRNA (UAS) - Lentiviral mouse Adora2a shRNA (UAS, RFP) (100)
GTR15273048 1 Vial

Lentiviral mouse Adora2a shRNA (UAS) - Lentiviral mouse Adora2a shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Human Monoclonal PD-1 Antibody (sasanlimab) [Janelia Fluor 669]
NBP3-28320JF669 0.1 mL

Human Monoclonal PD-1 Antibody (sasanlimab) [Janelia Fluor 669]

Sign In for Pricing
View Details
Anti-CD20 Reference Antibody (ocaratuzumab)
MBS9247393-01 0.1 mg

Anti-CD20 Reference Antibody (ocaratuzumab)

Sign In for Pricing
View Details
Anti-CD20 Reference Antibody (ocaratuzumab)
MBS9247393-02 5x 0.1 mg

Anti-CD20 Reference Antibody (ocaratuzumab)

Sign In for Pricing
View Details
RNU7-6P sgRNA CRISPR Lentivector (Human) (Target 3)
K1855104 1.0 µg DNA

RNU7-6P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PYCR2 3'UTR Lenti-reporter-Luc Vector
38244081 1.0 µg

PYCR2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details