Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FILIP1L (NM_001042459) Human Tagged ORF Clone
RC212867 10 µg

FILIP1L (NM_001042459) Human Tagged ORF Clone

Sign In for Pricing
View Details
Oligophrenin 1 Antibody
C48776-01 40 µL

Oligophrenin 1 Antibody

Sign In for Pricing
View Details
Oligophrenin 1 Antibody
C48776-02 100 µL

Oligophrenin 1 Antibody

Sign In for Pricing
View Details
Oligophrenin 1 Antibody
C48776-03 200 µL

Oligophrenin 1 Antibody

Sign In for Pricing
View Details
ILF3 Antibody
GWB-102DA0 0.05 mg

ILF3 Antibody

Sign In for Pricing
View Details
Ear2 sgRNA CRISPR Lentivector set (Mouse)
K3915501 3x 1.0 µg

Ear2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details