Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAXDC2 shRNA (UAS) - Lentiviral human FAXDC2 shRNA (UAS) (25)
GTR15147329 1 Vial

Lentiviral human FAXDC2 shRNA (UAS) - Lentiviral human FAXDC2 shRNA (UAS) (25)

Sign In for Pricing
View Details
CC2D1A Rabbit Monoclonal Antibody [Clone ID: 23GB3045]
TA424614S 20 µL

CC2D1A Rabbit Monoclonal Antibody [Clone ID: 23GB3045]

Sign In for Pricing
View Details
Mouse BGN (Biglycan) ELISA Kit
EK245942 96 Well

Mouse BGN (Biglycan) ELISA Kit

Sign In for Pricing
View Details
Gerbera Multiplication Medium w/ CaCl2, Vitamins, Tyrosine, Suc
PT002G-10X1L 1 unit

Gerbera Multiplication Medium w/ CaCl2, Vitamins, Tyrosine, Suc

Sign In for Pricing
View Details
Mouse PK ELISA Kit
E062912 1 Each

Mouse PK ELISA Kit

Sign In for Pricing
View Details
OVA Conjugated to HiLyte Fluor 647
B2011342 1 mg

OVA Conjugated to HiLyte Fluor 647

Sign In for Pricing
View Details