Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triphenylsilane for Synthesis
250845-01 5 g

Triphenylsilane for Synthesis

Sign In for Pricing
View Details
Triphenylsilane for Synthesis
250845-02 25 g

Triphenylsilane for Synthesis

Sign In for Pricing
View Details
2,2-Bis (4-methoxyphenyl) -1,2-diphenylethanone
004217 100 mg

2,2-Bis (4-methoxyphenyl) -1,2-diphenylethanone

Sign In for Pricing
View Details
CHRDL1 (NM_145234) Human Tagged Lenti ORF Clone
RC202635L4 10 µg

CHRDL1 (NM_145234) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Histone H4 (AcK16) Blocking Peptide
MBS8214624-01 1 mg

Histone H4 (AcK16) Blocking Peptide

Sign In for Pricing
View Details
Histone H4 (AcK16) Blocking Peptide
MBS8214624-02 5 mg

Histone H4 (AcK16) Blocking Peptide

Sign In for Pricing
View Details