Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALG9 Protein Vector (Rat) (pPM-C-His)
PV253257 500 ng

ALG9 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit anti-Cyclin D3 (pT283) Antibody
YLD2276-01 50 µL

Rabbit anti-Cyclin D3 (pT283) Antibody

Sign In for Pricing
View Details
Rabbit anti-Cyclin D3 (pT283) Antibody
YLD2276-02 100 µL

Rabbit anti-Cyclin D3 (pT283) Antibody

Sign In for Pricing
View Details
PMS1 discontinued
541189-01 30ul

PMS1 discontinued

Sign In for Pricing
View Details
PMS1 discontinued
541189-02 100 µL

PMS1 discontinued

Sign In for Pricing
View Details
FAS antibody
BF0557 100 µg

FAS antibody

Sign In for Pricing
View Details