Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Chemokine C-C-Motif Ligand 14 (CCL14) ELISA Kit
RD-CCL14-Hu-48Tests 48 Tests

Human Chemokine C-C-Motif Ligand 14 (CCL14) ELISA Kit

Sign In for Pricing
View Details
anti-human CD8-FITC
MBS666092-01 120 Tests

anti-human CD8-FITC

Sign In for Pricing
View Details
anti-human CD8-FITC
MBS666092-02 5x 120 Tests

anti-human CD8-FITC

Sign In for Pricing
View Details
CFH, Control Peptide (Complement Factor H, H Factor 1, HF, HF1, HF2, AHUS1, AMBP1, ARMD4, ARMS1, CFHL3, MGC88246)
147785 100 µg

CFH, Control Peptide (Complement Factor H, H Factor 1, HF, HF1, HF2, AHUS1, AMBP1, ARMD4, ARMS1, CFHL3, MGC88246)

Sign In for Pricing
View Details
Lentiviral mouse Pdhx shRNA (UAS) - Lentiviral mouse Pdhx shRNA (UAS, iRFP) plasmid
GTR15264676 1 Vial

Lentiviral mouse Pdhx shRNA (UAS) - Lentiviral mouse Pdhx shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
LINC00354 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV731428 1.0 µg DNA

LINC00354 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details