Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DIAPH2 sgRNA gene knockout kit - Lentiviral human DIAPH2 sgRNA gene knockout kit (100)
GTR15394309 1 Vial

Lentiviral human DIAPH2 sgRNA gene knockout kit - Lentiviral human DIAPH2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Coagulation Factor XIV/Protein C Recombinant Protein Antigen
NBP1-86509PEP 0.1 mL

Coagulation Factor XIV/Protein C Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Polystichum munitum Chlorophyll a-b binding protein type 1 member F3, chloroplastic (CABF3), partial
MBS7059669 Inquire

Recombinant Polystichum munitum Chlorophyll a-b binding protein type 1 member F3, chloroplastic (CABF3), partial

Sign In for Pricing
View Details
DOPE-PEG-CH2COOH, 2K
LP100121-2K 1 g

DOPE-PEG-CH2COOH, 2K

Sign In for Pricing
View Details
Recombinant Human Ras-related protein Rab-14 (RAB14)
MBS962065-01 0.02 mg (E-Coli)

Recombinant Human Ras-related protein Rab-14 (RAB14)

Sign In for Pricing
View Details
Recombinant Human Ras-related protein Rab-14 (RAB14)
MBS962065-02 0.1 mg (E-Coli)

Recombinant Human Ras-related protein Rab-14 (RAB14)

Sign In for Pricing
View Details