Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arrdc1 sgRNA CRISPR Lentivector set (Rat)
K6155601 3x 1.0 µg

Arrdc1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
TFDP3 (Transcription Factor Dp Family Member 3, Cancer/testis Antigen 30, CT30, DP4, Hepatocellular Carcinoma-associated Antigen 661, HCA661) (MaxLight 650)
MBS6225068-01 0.1 mL

TFDP3 (Transcription Factor Dp Family Member 3, Cancer/testis Antigen 30, CT30, DP4, Hepatocellular Carcinoma-associated Antigen 661, HCA661) (MaxLight 650)

Sign In for Pricing
View Details
TFDP3 (Transcription Factor Dp Family Member 3, Cancer/testis Antigen 30, CT30, DP4, Hepatocellular Carcinoma-associated Antigen 661, HCA661) (MaxLight 650)
MBS6225068-02 5x 0.1 mL

TFDP3 (Transcription Factor Dp Family Member 3, Cancer/testis Antigen 30, CT30, DP4, Hepatocellular Carcinoma-associated Antigen 661, HCA661) (MaxLight 650)

Sign In for Pricing
View Details
CDKN2A Antibody
MBS8001381-01 0.1 mg

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
MBS8001381-02 5x 0.1 mg

CDKN2A Antibody

Sign In for Pricing
View Details
DHRS1 (NM_138452) Human Recombinant Protein
TP304206 20 µg

DHRS1 (NM_138452) Human Recombinant Protein

Sign In for Pricing
View Details