Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LALBA, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LALBA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lalba-protein-human-hek-293-his.html

Purity

98.0

Smiles

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Formula

3906 (Gene_ID) P00709 (K20-L142) (Accession)

Molecular Weight

14 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp748 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
51113124 3x 1.0µg DNA

Zfp748 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Porcine Nuclear Envelope Pore Membrane Protein POM 121 (POM121) ELISA Kit
MBS9927090-01 48 Well

Porcine Nuclear Envelope Pore Membrane Protein POM 121 (POM121) ELISA Kit

Sign In for Pricing
View Details
Porcine Nuclear Envelope Pore Membrane Protein POM 121 (POM121) ELISA Kit
MBS9927090-02 96 Well

Porcine Nuclear Envelope Pore Membrane Protein POM 121 (POM121) ELISA Kit

Sign In for Pricing
View Details
Porcine Nuclear Envelope Pore Membrane Protein POM 121 (POM121) ELISA Kit
MBS9927090-03 5x 96 Well

Porcine Nuclear Envelope Pore Membrane Protein POM 121 (POM121) ELISA Kit

Sign In for Pricing
View Details
Porcine Nuclear Envelope Pore Membrane Protein POM 121 (POM121) ELISA Kit
MBS9927090-04 10x 96 Well

Porcine Nuclear Envelope Pore Membrane Protein POM 121 (POM121) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Rab9 effector protein with kelch motifs (Rabepk)
MBS1394181-01 0.02 mg (E-Coli)

Recombinant Mouse Rab9 effector protein with kelch motifs (Rabepk)

Sign In for Pricing
View Details