Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PMVK, Human (His)

PMVK proteins play a key role in cellular metabolism by catalyzing the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate, leading to the production of mevalonate diphosphate and ADP. This enzymatic activity represents a key step in the mevalonate-mediated biosynthesis of isopentenyl diphosphate, a precursor for the synthesis of various polyisoprene metabolites. PMVK Protein, Human (His) is the recombinant human-derived PMVK protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PMVK Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pmvk-protein-human-his.html

Smiles

MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL

Molecular Formula

10654 (Gene_ID) Q15126 (M1-L192) (Accession)

Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTL antibody
FNab09095 100 µg

TTL antibody

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD11c Antibody[BU15]
E-AB-F1118L-01 20 Tests

Elab Fluor® 488 Anti-Human CD11c Antibody[BU15]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD11c Antibody[BU15]
E-AB-F1118L-02 100 Tests

Elab Fluor® 488 Anti-Human CD11c Antibody[BU15]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD11c Antibody[BU15]
E-AB-F1118L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD11c Antibody[BU15]

Sign In for Pricing
View Details
DCAMKL1 (DCLK1) (N-term) Rabbit Polyclonal Antibody
AP13897PU-N 400 µL

DCAMKL1 (DCLK1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Nitroso-3-azabicyclo[3.3.0]octane-d4
TRC-N524902-50MG 50 mg

N-Nitroso-3-azabicyclo[3.3.0]octane-d4

Sign In for Pricing
View Details