Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PMVK, Human (His)

PMVK proteins play a key role in cellular metabolism by catalyzing the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate, leading to the production of mevalonate diphosphate and ADP. This enzymatic activity represents a key step in the mevalonate-mediated biosynthesis of isopentenyl diphosphate, a precursor for the synthesis of various polyisoprene metabolites. PMVK Protein, Human (His) is the recombinant human-derived PMVK protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PMVK Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pmvk-protein-human-his.html

Smiles

MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL

Molecular Formula

10654 (Gene_ID) Q15126 (M1-L192) (Accession)

Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRAS (NM_002524) Human Over-expression Lysate
LY400901 100 µg

NRAS (NM_002524) Human Over-expression Lysate

Sign In for Pricing
View Details
AMN1 (NM_207337) Human Over-expression Lysate
LY403964 100 µg

AMN1 (NM_207337) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS500068 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105UM1-01 25 µg

Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105UM1-02 100 µg

Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
Cytokeratin, LMW (KRTL/1077), CF568 conjugate, 0.1mg/mL
BNC681077-100 1x 100 µL

Cytokeratin, LMW (KRTL/1077), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details