Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin K, Rat (His)

Cathepsin K protein is a thiol protease that is essential for osteoclastic bone resorption and regulation of bone remodeling. It exhibits potent endoprotease activity against fibrinogen under acidic conditions, suggesting its role in extracellular matrix degradation. Cathepsin K Protein, Rat (His) is the recombinant rat-derived Cathepsin K protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin K Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-k-protein-rat-his.html

Purity

90.00

Smiles

VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGESWGNKGYVLLARNKNNACGITNLASFPKM

Molecular Formula

29175 (Gene_ID) O35186 (V115-M329) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP1, NT (Ubiquitin Carboxyl-terminal Hydrolase 1, Ubiquitin Thioesterase 1, Ubiquitin-specific-processing Protease 1, Deubiquitinating Enzyme 1, hUBP) (APC)
MBS6504947-01 0.2 mL

USP1, NT (Ubiquitin Carboxyl-terminal Hydrolase 1, Ubiquitin Thioesterase 1, Ubiquitin-specific-processing Protease 1, Deubiquitinating Enzyme 1, hUBP) (APC)

Sign In for Pricing
View Details
USP1, NT (Ubiquitin Carboxyl-terminal Hydrolase 1, Ubiquitin Thioesterase 1, Ubiquitin-specific-processing Protease 1, Deubiquitinating Enzyme 1, hUBP) (APC)
MBS6504947-02 5x 0.2 mL

USP1, NT (Ubiquitin Carboxyl-terminal Hydrolase 1, Ubiquitin Thioesterase 1, Ubiquitin-specific-processing Protease 1, Deubiquitinating Enzyme 1, hUBP) (APC)

Sign In for Pricing
View Details
Porcine F box only protein 36 (FBXO36) ELISA Kit
GTR10369993 96 Well

Porcine F box only protein 36 (FBXO36) ELISA Kit

Sign In for Pricing
View Details
GasPak EZ CO2 Pouch System
96731 20/Pack

GasPak EZ CO2 Pouch System

Sign In for Pricing
View Details
Anti-GADD34 Rabbit pAb
GB11809 100 μL

Anti-GADD34 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Salmonella agona 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)
MBS1178394-01 0.02 mg (E-Coli)

Recombinant Salmonella agona 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB)

Sign In for Pricing
View Details