Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-2/CD86, Cynomolgus/Rhesus Macaque (HEK293, hFc)

B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc) is the recombinant Rhesus Macaque, cynomolgus-derived B7-2/CD86 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc), Rhesus Macaque; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ildr2-b7-2-protein-cynomolgus-hek-293-fc.html

Smiles

APLKIQAYFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKEKFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRIHQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQPPPDH

Molecular Formula

/ (Gene_ID) A0A2K5TTJ8/XP_005548057.1 (A18-H239) (Accession)

Molecular Weight

Approximately 70-100 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog