Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-2/CD86, Cynomolgus/Rhesus Macaque (HEK293, hFc)

B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc) is the recombinant Rhesus Macaque, cynomolgus-derived B7-2/CD86 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc), Rhesus Macaque; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ildr2-b7-2-protein-cynomolgus-hek-293-fc.html

Smiles

APLKIQAYFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKEKFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRIHQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQPPPDH

Molecular Formula

/ (Gene_ID) A0A2K5TTJ8/XP_005548057.1 (A18-H239) (Accession)

Molecular Weight

Approximately 70-100 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-100 1x 100 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-500 1x 500 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-500 1x 500 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details