Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thioredoxin-1/TRXA, E.coli (His)

Thioredoxin-1/TRXA Protein participates in diverse redox reactions, facilitating reversible oxidation of its active center dithiol to form a disulfide bond and catalyzing critical dithiol-disulfide exchanges. Operating as a monomer, Thioredoxin-1 exhibits versatility in redox functions and interacts with bacteriophage T3 DNA polymerase, suggesting broader involvement in molecular processes beyond its primary redox activities. Thioredoxin-1/TRXA Protein, E.coli (His) is the recombinant E. coli-derived Thioredoxin-1/TRXA protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Thioredoxin-1/TRXA Protein, E.coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thioredoxin-1-protein-e-coli-his.html

Purity

98.0

Smiles

SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

Molecular Formula

69484444 (Gene_ID) P0AA25 (S2-A109) (Accession)

Molecular Weight

Approximately 15.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

0610038D11Rik (BC019418) Mouse Tagged ORF Clone
MG200396 10 µg

0610038D11Rik (BC019418) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ExoBriteTM 555/575 True EV Membrane Stain, 500 labelings
#30130 1x 500 µL

ExoBriteTM 555/575 True EV Membrane Stain, 500 labelings

Sign In for Pricing
View Details
RDH12 Human qPCR Primer Pair (NM_152443)
HP217706 200 Reactions

RDH12 Human qPCR Primer Pair (NM_152443)

Sign In for Pricing
View Details
Mitochondrial Marker (MTC719), Biotin conjugate, 0.1mg/mL
BNCB0719-500 1x 500 µL

Mitochondrial Marker (MTC719), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Baicalein
TRC-B115300-250MG 250 mg

Baicalein

Sign In for Pricing
View Details
OR2M2 (NM_001004688) Human Over-expression Lysate
LY423876 100 µg

OR2M2 (NM_001004688) Human Over-expression Lysate

Sign In for Pricing
View Details